Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 58412..59157 Replicon plasmid 2
Accession NZ_LR025093
Organism Klebsiella pneumoniae isolate KP9201

Toxin (Protein)


Gene name tacT Uniprot ID A0A331KSM6
Locus tag KP920_RS26550 Protein ID WP_032408901.1
Coordinates 58666..59157 (+) Length 164 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID -
Locus tag KP920_RS26545 Protein ID WP_014386183.1
Coordinates 58412..58678 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KP920_RS26485 53964..54377 - 414 WP_013023817.1 helix-turn-helix domain-containing protein -
KP920_RS26490 54378..54656 - 279 WP_004152721.1 helix-turn-helix domain-containing protein -
KP920_RS26495 54646..54966 - 321 WP_014386190.1 type II toxin-antitoxin system RelE/ParE family toxin -
KP920_RS26500 55047..55271 - 225 WP_014386189.1 hypothetical protein -
KP920_RS26505 55282..55494 - 213 WP_014386188.1 hypothetical protein -
KP920_RS26510 55556..55882 - 327 WP_014386187.1 hypothetical protein -
KP920_RS26525 56519..56869 - 351 WP_014386186.1 hypothetical protein -
KP920_RS26530 56866..57138 - 273 WP_032408902.1 hypothetical protein -
KP920_RS26535 57328..57813 + 486 WP_014386185.1 hypothetical protein -
KP920_RS26540 58057..58215 - 159 WP_014386184.1 type I toxin-antitoxin system Hok family toxin -
KP920_RS26545 58412..58678 + 267 WP_014386183.1 DUF1778 domain-containing protein Antitoxin
KP920_RS26550 58666..59157 + 492 WP_032408901.1 GNAT family N-acetyltransferase Toxin
KP920_RS26555 59598..59849 - 252 WP_032408900.1 aldo/keto reductase -
KP920_RS26560 60046..61638 - 1593 Protein_68 IS66 family transposase -
KP920_RS26565 61669..62019 - 351 WP_014386180.1 IS66 family insertion sequence element accessory protein TnpB -
KP920_RS26570 62016..62456 - 441 WP_014386179.1 IS66 family insertion sequence hypothetical protein -
KP920_RS26575 62718..63473 - 756 WP_032408898.1 DeoR/GlpR family DNA-binding transcription regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / blaTEM-1B / dfrA12 / aadA2 / qacE / sul1 / mph(A) - 1..231732 231732


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(89-149)

Antitoxin

Vibrio phage ICP1, Orf50

(2-87)


Sequences

Toxin        


Download         Length: 164 a.a.        Molecular weight: 17667.46 Da        Isoelectric Point: 8.8757

>T285845 WP_032408901.1 NZ_LR025093:58666-59157 [Klebsiella pneumoniae]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT

Download         Length: 492 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10090.66 Da        Isoelectric Point: 5.1169

>AT285845 WP_014386183.1 NZ_LR025093:58412-58678 [Klebsiella pneumoniae]
MKSDVQLNIRAKEAQRALIDTAAEILHKSRTDFILEMACQAAENVILDRRMFNLNDEQYAEFIDMLDAPVTANPAMEKLL
ARKPQWAK

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A331KSM6

Antitoxin

Source ID Structure

References