Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4828755..4829380 | Replicon | chromosome |
Accession | NZ_LR025092 | ||
Organism | Klebsiella pneumoniae isolate KP9201 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | KP920_RS24225 | Protein ID | WP_040182550.1 |
Coordinates | 4828997..4829380 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | KP920_RS24220 | Protein ID | WP_004150355.1 |
Coordinates | 4828755..4828997 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KP920_RS24195 | 4824746..4825345 | + | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
KP920_RS24200 | 4825339..4826199 | + | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
KP920_RS24205 | 4826196..4826633 | + | 438 | WP_002882809.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
KP920_RS24210 | 4826678..4827619 | + | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
KP920_RS24215 | 4827633..4828550 | - | 918 | WP_023302328.1 | alpha/beta hydrolase | - |
KP920_RS24220 | 4828755..4828997 | + | 243 | WP_004150355.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
KP920_RS24225 | 4828997..4829380 | + | 384 | WP_040182550.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
KP920_RS24230 | 4829554..4830483 | - | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
KP920_RS24235 | 4830480..4831115 | - | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
KP920_RS24240 | 4831112..4832014 | - | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14376.67 Da Isoelectric Point: 9.5352
>T285843 WP_040182550.1 NZ_LR025092:4828997-4829380 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLKLITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLKLITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|