Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3964303..3964960 | Replicon | chromosome |
| Accession | NZ_LR025092 | ||
| Organism | Klebsiella pneumoniae isolate KP9201 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | KP920_RS19870 | Protein ID | WP_002916310.1 |
| Coordinates | 3964303..3964713 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | KP920_RS19875 | Protein ID | WP_002916312.1 |
| Coordinates | 3964694..3964960 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KP920_RS19850 | 3960303..3962036 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| KP920_RS19855 | 3962042..3962755 | - | 714 | WP_004185548.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| KP920_RS19860 | 3962778..3963674 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| KP920_RS19865 | 3963775..3964296 | + | 522 | WP_004144730.1 | flavodoxin FldB | - |
| KP920_RS19870 | 3964303..3964713 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
| KP920_RS19875 | 3964694..3964960 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| KP920_RS19880 | 3965206..3966189 | + | 984 | WP_004185555.1 | tRNA-modifying protein YgfZ | - |
| KP920_RS19885 | 3966340..3966999 | - | 660 | WP_002916317.1 | hemolysin III family protein | - |
| KP920_RS19890 | 3967163..3967474 | - | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| KP920_RS19895 | 3967524..3968252 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| KP920_RS19900 | 3968371..3969804 | + | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T285840 WP_002916310.1 NZ_LR025092:c3964713-3964303 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |