Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 214589..215232 Replicon plasmid 2
Accession NZ_LR025089
Organism Klebsiella pneumoniae isolate KP980

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag KP980_RS27415 Protein ID WP_014386165.1
Coordinates 214589..215005 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag KP980_RS27420 Protein ID WP_032408893.1
Coordinates 215002..215232 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KP980_RS27390 211209..211640 + 432 WP_014386161.1 conjugation system SOS inhibitor PsiB -
KP980_RS27395 211637..212365 + 729 WP_014386162.1 plasmid SOS inhibition protein A -
KP980_RS27400 212362..212688 + 327 WP_004152639.1 hypothetical protein -
KP980_RS27405 212744..213118 + 375 WP_032408891.1 hypothetical protein -
KP980_RS27410 213298..214266 - 969 WP_074422984.1 IS5 family transposase -
KP980_RS27415 214589..215005 - 417 WP_014386165.1 PIN domain-containing protein Toxin
KP980_RS27420 215002..215232 - 231 WP_032408893.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
KP980_RS27430 215552..215986 + 435 WP_000103648.1 RidA family protein -
KP980_RS27435 215991..216665 + 675 WP_014386166.1 DUF1028 domain-containing protein -
KP980_RS27440 216681..217838 + 1158 WP_032408895.1 acetylornithine deacetylase -
KP980_RS27445 218009..219157 + 1149 WP_014386168.1 ABC transporter ATP-binding protein -
KP980_RS27450 219164..220159 + 996 WP_000611945.1 NAD(P)H-quinone oxidoreductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mph(A) / sul1 / qacE / aadA2 / dfrA12 / blaTEM-1B / blaCTX-M-15 / aac(6')-Ib-cr / blaOXA-1 / tet(A) - 1..220174 220174
- flank IS/Tn - - 213298..214266 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-130)

Antitoxin

SpoVT-AbrB domain

(7-55)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15127.44 Da        Isoelectric Point: 7.8841

>T285831 WP_014386165.1 NZ_LR025089:c215005-214589 [Klebsiella pneumoniae]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8854.89 Da        Isoelectric Point: 4.5112

>AT285831 WP_032408893.1 NZ_LR025089:c215232-215002 [Klebsiella pneumoniae]
MRTVSVFRNGNNRAIRLPRDLDFDGVNELEIIREGDTLILRPVKPSWSSFRQEEKADADFMAERENVVSDEGRFEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References