Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 139970..140706 Replicon plasmid 2
Accession NZ_LR025089
Organism Klebsiella pneumoniae isolate KP980

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag KP980_RS26980 Protein ID WP_003026803.1
Coordinates 139970..140452 (-) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag KP980_RS26985 Protein ID WP_003026799.1
Coordinates 140440..140706 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KP980_RS26965 135607..136569 + 963 WP_004152113.1 M48 family metalloprotease -
KP980_RS26970 136657..137911 + 1255 Protein_154 IS3 family transposase -
KP980_RS26975 138412..139758 - 1347 WP_020314316.1 ISNCY family transposase -
KP980_RS26980 139970..140452 - 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
KP980_RS26985 140440..140706 - 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
KP980_RS26990 140882..141136 - 255 WP_004152108.1 hypothetical protein -
KP980_RS26995 141212..141469 - 258 WP_004152107.1 hypothetical protein -
KP980_RS27000 141518..141721 - 204 WP_004152106.1 hemolysin expression modulator Hha -
KP980_RS27005 141755..142123 - 369 WP_004152105.1 hypothetical protein -
KP980_RS27010 142167..142661 - 495 WP_004152104.1 DNA-binding protein -
KP980_RS27015 142692..143267 - 576 WP_004152103.1 hypothetical protein -
KP980_RS27020 143255..143524 - 270 WP_004152102.1 hypothetical protein -
KP980_RS27025 143882..144232 + 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
KP980_RS27030 144282..144644 + 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mph(A) / sul1 / qacE / aadA2 / dfrA12 / blaTEM-1B / blaCTX-M-15 / aac(6')-Ib-cr / blaOXA-1 / tet(A) - 1..220174 220174


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T285830 WP_003026803.1 NZ_LR025089:c140452-139970 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT285830 WP_003026799.1 NZ_LR025089:c140706-140440 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References