Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 18209..18954 Replicon plasmid 2
Accession NZ_LR025089
Organism Klebsiella pneumoniae isolate KP980

Toxin (Protein)


Gene name tacT Uniprot ID A0A331KSM6
Locus tag KP980_RS26205 Protein ID WP_032408901.1
Coordinates 18209..18700 (-) Length 164 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID -
Locus tag KP980_RS26210 Protein ID WP_014386183.1
Coordinates 18688..18954 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KP980_RS26180 13893..14648 + 756 WP_032408898.1 DeoR/GlpR family DNA-binding transcription regulator -
KP980_RS26185 14910..15350 + 441 WP_014386179.1 IS66 family insertion sequence hypothetical protein -
KP980_RS26190 15347..15697 + 351 WP_014386180.1 IS66 family insertion sequence element accessory protein TnpB -
KP980_RS26195 15728..17320 + 1593 Protein_17 IS66 family transposase -
KP980_RS26200 17517..17768 + 252 WP_032408900.1 aldo/keto reductase -
KP980_RS26205 18209..18700 - 492 WP_032408901.1 GNAT family N-acetyltransferase Toxin
KP980_RS26210 18688..18954 - 267 WP_014386183.1 DUF1778 domain-containing protein Antitoxin
KP980_RS26215 19151..19309 + 159 WP_014386184.1 type I toxin-antitoxin system Hok family toxin -
KP980_RS26220 19553..20038 - 486 WP_014386185.1 hypothetical protein -
KP980_RS26225 20228..20500 + 273 WP_032408902.1 hypothetical protein -
KP980_RS26230 20497..20847 + 351 WP_014386186.1 hypothetical protein -
KP980_RS26245 21484..21810 + 327 WP_014386187.1 hypothetical protein -
KP980_RS26250 21872..22084 + 213 WP_014386188.1 hypothetical protein -
KP980_RS26255 22095..22319 + 225 WP_014386189.1 hypothetical protein -
KP980_RS26260 22400..22720 + 321 WP_014386190.1 type II toxin-antitoxin system RelE/ParE family toxin -
KP980_RS26265 22710..22988 + 279 WP_004152721.1 helix-turn-helix domain-containing protein -
KP980_RS26270 22989..23402 + 414 WP_013023817.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mph(A) / sul1 / qacE / aadA2 / dfrA12 / blaTEM-1B / blaCTX-M-15 / aac(6')-Ib-cr / blaOXA-1 / tet(A) - 1..220174 220174


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(89-149)

Antitoxin

Vibrio phage ICP1, Orf50

(2-87)


Sequences

Toxin        


Download         Length: 164 a.a.        Molecular weight: 17667.46 Da        Isoelectric Point: 8.8757

>T285829 WP_032408901.1 NZ_LR025089:c18700-18209 [Klebsiella pneumoniae]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT

Download         Length: 492 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10090.66 Da        Isoelectric Point: 5.1169

>AT285829 WP_014386183.1 NZ_LR025089:c18954-18688 [Klebsiella pneumoniae]
MKSDVQLNIRAKEAQRALIDTAAEILHKSRTDFILEMACQAAENVILDRRMFNLNDEQYAEFIDMLDAPVTANPAMEKLL
ARKPQWAK

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A331KSM6

Antitoxin

Source ID Structure

References