Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 18209..18954 | Replicon | plasmid 2 |
| Accession | NZ_LR025089 | ||
| Organism | Klebsiella pneumoniae isolate KP980 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A331KSM6 |
| Locus tag | KP980_RS26205 | Protein ID | WP_032408901.1 |
| Coordinates | 18209..18700 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | KP980_RS26210 | Protein ID | WP_014386183.1 |
| Coordinates | 18688..18954 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KP980_RS26180 | 13893..14648 | + | 756 | WP_032408898.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| KP980_RS26185 | 14910..15350 | + | 441 | WP_014386179.1 | IS66 family insertion sequence hypothetical protein | - |
| KP980_RS26190 | 15347..15697 | + | 351 | WP_014386180.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| KP980_RS26195 | 15728..17320 | + | 1593 | Protein_17 | IS66 family transposase | - |
| KP980_RS26200 | 17517..17768 | + | 252 | WP_032408900.1 | aldo/keto reductase | - |
| KP980_RS26205 | 18209..18700 | - | 492 | WP_032408901.1 | GNAT family N-acetyltransferase | Toxin |
| KP980_RS26210 | 18688..18954 | - | 267 | WP_014386183.1 | DUF1778 domain-containing protein | Antitoxin |
| KP980_RS26215 | 19151..19309 | + | 159 | WP_014386184.1 | type I toxin-antitoxin system Hok family toxin | - |
| KP980_RS26220 | 19553..20038 | - | 486 | WP_014386185.1 | hypothetical protein | - |
| KP980_RS26225 | 20228..20500 | + | 273 | WP_032408902.1 | hypothetical protein | - |
| KP980_RS26230 | 20497..20847 | + | 351 | WP_014386186.1 | hypothetical protein | - |
| KP980_RS26245 | 21484..21810 | + | 327 | WP_014386187.1 | hypothetical protein | - |
| KP980_RS26250 | 21872..22084 | + | 213 | WP_014386188.1 | hypothetical protein | - |
| KP980_RS26255 | 22095..22319 | + | 225 | WP_014386189.1 | hypothetical protein | - |
| KP980_RS26260 | 22400..22720 | + | 321 | WP_014386190.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| KP980_RS26265 | 22710..22988 | + | 279 | WP_004152721.1 | helix-turn-helix domain-containing protein | - |
| KP980_RS26270 | 22989..23402 | + | 414 | WP_013023817.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mph(A) / sul1 / qacE / aadA2 / dfrA12 / blaTEM-1B / blaCTX-M-15 / aac(6')-Ib-cr / blaOXA-1 / tet(A) | - | 1..220174 | 220174 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17667.46 Da Isoelectric Point: 8.8757
>T285829 WP_032408901.1 NZ_LR025089:c18700-18209 [Klebsiella pneumoniae]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|