Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 3804467..3805092 | Replicon | chromosome |
Accession | NZ_LR025088 | ||
Organism | Klebsiella pneumoniae isolate KP980 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | KP980_RS19125 | Protein ID | WP_040182550.1 |
Coordinates | 3804709..3805092 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | KP980_RS19120 | Protein ID | WP_004150355.1 |
Coordinates | 3804467..3804709 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KP980_RS19095 | 3800458..3801057 | + | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
KP980_RS19100 | 3801051..3801911 | + | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
KP980_RS19105 | 3801908..3802345 | + | 438 | WP_002882809.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
KP980_RS19110 | 3802390..3803331 | + | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
KP980_RS19115 | 3803345..3804262 | - | 918 | WP_023302328.1 | alpha/beta hydrolase | - |
KP980_RS19120 | 3804467..3804709 | + | 243 | WP_004150355.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
KP980_RS19125 | 3804709..3805092 | + | 384 | WP_040182550.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
KP980_RS19130 | 3805266..3806195 | - | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
KP980_RS19135 | 3806192..3806827 | - | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
KP980_RS19140 | 3806824..3807726 | - | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14376.67 Da Isoelectric Point: 9.5352
>T285824 WP_040182550.1 NZ_LR025088:3804709-3805092 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLKLITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLKLITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|