Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2940015..2940672 | Replicon | chromosome |
Accession | NZ_LR025088 | ||
Organism | Klebsiella pneumoniae isolate KP980 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | KP980_RS14770 | Protein ID | WP_002916310.1 |
Coordinates | 2940015..2940425 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | KP980_RS14775 | Protein ID | WP_002916312.1 |
Coordinates | 2940406..2940672 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KP980_RS14750 | 2936015..2937748 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
KP980_RS14755 | 2937754..2938467 | - | 714 | WP_004185548.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
KP980_RS14760 | 2938490..2939386 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
KP980_RS14765 | 2939487..2940008 | + | 522 | WP_004144730.1 | flavodoxin FldB | - |
KP980_RS14770 | 2940015..2940425 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
KP980_RS14775 | 2940406..2940672 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
KP980_RS14780 | 2940918..2941901 | + | 984 | WP_004185555.1 | tRNA-modifying protein YgfZ | - |
KP980_RS14785 | 2942052..2942711 | - | 660 | WP_002916317.1 | hemolysin III family protein | - |
KP980_RS14790 | 2942875..2943186 | - | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
KP980_RS14795 | 2943236..2943964 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
KP980_RS14800 | 2944083..2945516 | + | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T285821 WP_002916310.1 NZ_LR025088:c2940425-2940015 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |