Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Txe-Axe/Txe-RelB
Location 13168..13687 Replicon plasmid III
Accession NZ_LN999989
Organism Enterococcus faecium isolate EFE11651

Toxin (Protein)


Gene name Txe Uniprot ID Q848U6
Locus tag EFE1165_RS15425 Protein ID WP_000588503.1
Coordinates 13168..13425 (-) Length 86 a.a.

Antitoxin (Protein)


Gene name Axe Uniprot ID Q83WJ8
Locus tag EFE1165_RS15430 Protein ID WP_000388479.1
Coordinates 13418..13687 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EFE1165_RS15395 8207..8497 - 291 WP_000026576.1 hypothetical protein -
EFE1165_RS15400 8633..8812 - 180 WP_001021554.1 hypothetical protein -
EFE1165_RS15405 8809..9159 - 351 WP_000568378.1 hypothetical protein -
EFE1165_RS15410 9152..10477 - 1326 WP_000969590.1 Y-family DNA polymerase -
EFE1165_RS15415 10927..11541 + 615 WP_001261742.1 recombinase family protein -
EFE1165_RS15420 11706..12530 - 825 WP_001809248.1 hypothetical protein -
EFE1165_RS16050 12554..12709 - 156 WP_002347142.1 hypothetical protein -
EFE1165_RS15425 13168..13425 - 258 WP_000588503.1 Txe/YoeB family addiction module toxin Toxin
EFE1165_RS15430 13418..13687 - 270 WP_000388479.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EFE1165_RS15435 13818..13997 - 180 WP_001120991.1 hypothetical protein -
EFE1165_RS15445 14378..15073 - 696 WP_002326819.1 hypothetical protein -
EFE1165_RS15450 15135..15815 + 681 WP_001015311.1 IS6-like element IS1216 family transposase -
EFE1165_RS15455 15869..16249 + 381 Protein_22 class I SAM-dependent methyltransferase -
EFE1165_RS15460 16282..17190 + 909 WP_001255866.1 aminoglycoside nucleotidyltransferase ANT(6)-Ia -
EFE1165_RS15465 17187..17729 + 543 WP_000627290.1 streptothricin N-acetyltransferase Sat4 -
EFE1165_RS15470 17822..18616 + 795 WP_001096887.1 aminoglycoside O-phosphotransferase APH(3')-IIIa -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid cat(pC233) / ant(6)-Ia / aph(3')-III / erm(B) - 1..32402 32402


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-85)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-72)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10206.53 Da        Isoelectric Point: 8.4369

>T285815 WP_000588503.1 NZ_LN999989:c13425-13168 [Enterococcus faecium]
MIKAWSDDAWDDYLYWHEQGNKSNIKKINKLIKDIDRSPFAGLGKPEPLKHDLSGKWSRRITDEHRLIYRVENETIFIYS
AKDHY

Download         Length: 258 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10373.51 Da        Isoelectric Point: 4.4346

>AT285815 WP_000388479.1 NZ_LN999989:c13687-13418 [Enterococcus faecium]
MEAVAYSNFRQNLRSYMKQVNEDAETLIVTSKDVEDTVVVLSKRDYDSMQETLRTLSNNYVMEKIRRGDEQFSKGAFKTH
DLIEVESDD

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A828ZXQ8

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZWU7

References