Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 480035..480606 | Replicon | chromosome |
| Accession | NZ_LN999844 | ||
| Organism | Enterococcus faecium isolate EFE10021 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S4EH17 |
| Locus tag | EFE1002_RS02245 | Protein ID | WP_002306003.1 |
| Coordinates | 480265..480606 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A828ZZN9 |
| Locus tag | EFE1002_RS02240 | Protein ID | WP_002323011.1 |
| Coordinates | 480035..480265 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EFE1002_RS02215 | 475169..476500 | + | 1332 | WP_002331664.1 | FAD-containing oxidoreductase | - |
| EFE1002_RS02220 | 476522..477148 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
| EFE1002_RS02225 | 477331..477912 | + | 582 | WP_002331663.1 | TetR/AcrR family transcriptional regulator | - |
| EFE1002_RS02230 | 478644..479219 | + | 576 | WP_002331662.1 | SOS response-associated peptidase family protein | - |
| EFE1002_RS02235 | 479410..479748 | - | 339 | WP_002306002.1 | hypothetical protein | - |
| EFE1002_RS02240 | 480035..480265 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
| EFE1002_RS02245 | 480265..480606 | + | 342 | WP_002306003.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EFE1002_RS02250 | 481456..481641 | + | 186 | WP_002304207.1 | hypothetical protein | - |
| EFE1002_RS02255 | 482146..482340 | + | 195 | WP_002295146.1 | hypothetical protein | - |
| EFE1002_RS12710 | 482531..482780 | + | 250 | Protein_452 | transposase | - |
| EFE1002_RS02265 | 483024..483854 | - | 831 | WP_002286789.1 | manganese catalase family protein | - |
| EFE1002_RS02270 | 484062..485396 | + | 1335 | WP_002286788.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13229.67 Da Isoelectric Point: 10.3190
>T285811 WP_002306003.1 NZ_LN999844:480265-480606 [Enterococcus faecium]
VSGERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKKRKLKKIENLPLQDMAKIDQIIQYMF
VSGERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKKRKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S4EH17 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A828ZZN9 |