Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yxiD-yxxD/- |
Location | 3404738..3405526 | Replicon | chromosome |
Accession | NZ_LN999829 | ||
Organism | Bacillus velezensis strain B25 |
Toxin (Protein)
Gene name | yxiD | Uniprot ID | - |
Locus tag | BAMMD1_RS19280 | Protein ID | WP_079891856.1 |
Coordinates | 3405185..3405526 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yxxD | Uniprot ID | - |
Locus tag | BAMMD1_RS16165 | Protein ID | WP_015387595.1 |
Coordinates | 3404738..3405175 (-) | Length | 146 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BAMMD1_RS16130 | 3400267..3400803 | + | 537 | WP_003151296.1 | chromate resistance efflux protein ChrA | - |
BAMMD1_RS16135 | 3400830..3401048 | - | 219 | WP_003151295.1 | hypothetical protein | - |
BAMMD1_RS16140 | 3401045..3401590 | - | 546 | WP_043867489.1 | flavodoxin family protein | - |
BAMMD1_RS16145 | 3401713..3402594 | + | 882 | WP_003151293.1 | LysR family transcriptional regulator | - |
BAMMD1_RS16150 | 3402664..3403395 | - | 732 | WP_060387205.1 | endonuclease V | - |
BAMMD1_RS16155 | 3403435..3403935 | - | 501 | WP_015387596.1 | hypothetical protein | - |
BAMMD1_RS16160 | 3404127..3404567 | - | 441 | Protein_3208 | SMI1/KNR4 family protein | - |
BAMMD1_RS16165 | 3404738..3405175 | - | 438 | WP_015387595.1 | SMI1/KNR4 family protein | Antitoxin |
BAMMD1_RS19280 | 3405185..3405526 | - | 342 | WP_079891856.1 | HNH endonuclease | Toxin |
BAMMD1_RS19285 | 3406145..3406483 | - | 339 | Protein_3211 | transposase | - |
BAMMD1_RS18995 | 3407122..3407587 | - | 466 | Protein_3212 | DUF2004 domain-containing protein | - |
BAMMD1_RS19085 | 3407589..3408114 | - | 526 | Protein_3213 | HNH endonuclease | - |
BAMMD1_RS16185 | 3408284..3408589 | - | 306 | WP_003151282.1 | hypothetical protein | - |
BAMMD1_RS16190 | 3408606..3410351 | - | 1746 | WP_060387206.1 | ribonuclease YeeF family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13224.74 Da Isoelectric Point: 9.6942
>T285810 WP_079891856.1 NZ_LN999829:c3405526-3405185 [Bacillus velezensis]
IKEALRNNNYEKLTPKETAKHRSKFTSSLKDRLIAEWEEKTNQKWPRYTEEVFDKHGEVARSIGQPYDAHHIIENNFGGP
HEWWNIHPAKYPDEHQAGIHGKGAPSGKLFPRR
IKEALRNNNYEKLTPKETAKHRSKFTSSLKDRLIAEWEEKTNQKWPRYTEEVFDKHGEVARSIGQPYDAHHIIENNFGGP
HEWWNIHPAKYPDEHQAGIHGKGAPSGKLFPRR
Download Length: 342 bp
Antitoxin
Download Length: 146 a.a. Molecular weight: 16992.02 Da Isoelectric Point: 3.8929
>AT285810 WP_015387595.1 NZ_LN999829:c3405175-3404738 [Bacillus velezensis]
MAEFEFINHLENKTYKVPEEDILKAEQRMNVDIPNDLKQLYLEVGYGFIKGESDNAINRILGPGAVADIRLREGIFEFDP
DLGELYDDENKLIFFEVNEGVYISIDLRLANNPIFYFDTQIAESLEDFFKKFLNDNEYYIDLIED
MAEFEFINHLENKTYKVPEEDILKAEQRMNVDIPNDLKQLYLEVGYGFIKGESDNAINRILGPGAVADIRLREGIFEFDP
DLGELYDDENKLIFFEVNEGVYISIDLRLANNPIFYFDTQIAESLEDFFKKFLNDNEYYIDLIED
Download Length: 438 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|