Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1223459..1224376 | Replicon | chromosome |
Accession | NZ_LN999829 | ||
Organism | Bacillus velezensis strain B25 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | A0A6A8LGT8 |
Locus tag | BAMMD1_RS06170 | Protein ID | WP_003154806.1 |
Coordinates | 1223630..1224376 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | - |
Locus tag | BAMMD1_RS06165 | Protein ID | WP_060386896.1 |
Coordinates | 1223459..1223629 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BAMMD1_RS06130 | 1218691..1220313 | + | 1623 | WP_024085192.1 | pyocin knob domain-containing protein | - |
BAMMD1_RS06135 | 1220326..1220697 | + | 372 | WP_024085193.1 | hypothetical protein | - |
BAMMD1_RS06140 | 1220703..1220900 | + | 198 | WP_003154819.1 | XkdX family protein | - |
BAMMD1_RS06145 | 1220957..1221718 | + | 762 | WP_024085194.1 | hypothetical protein | - |
BAMMD1_RS06150 | 1221770..1222033 | + | 264 | WP_032866112.1 | hemolysin XhlA family protein | - |
BAMMD1_RS06155 | 1222047..1222310 | + | 264 | WP_003154813.1 | phage holin | - |
BAMMD1_RS06160 | 1222324..1223202 | + | 879 | WP_024085195.1 | N-acetylmuramoyl-L-alanine amidase | - |
BAMMD1_RS06165 | 1223459..1223629 | - | 171 | WP_060386896.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
BAMMD1_RS06170 | 1223630..1224376 | - | 747 | WP_003154806.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
BAMMD1_RS06175 | 1224481..1225479 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
BAMMD1_RS06180 | 1225492..1226109 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
BAMMD1_RS06185 | 1226395..1227711 | - | 1317 | WP_046559522.1 | amino acid permease | - |
BAMMD1_RS06190 | 1228035..1228985 | + | 951 | WP_060386897.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29034.50 Da Isoelectric Point: 4.6947
>T285809 WP_003154806.1 NZ_LN999829:c1224376-1223630 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|