Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 464201..464838 | Replicon | chromosome |
Accession | NZ_LN999829 | ||
Organism | Bacillus velezensis strain B25 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | BAMMD1_RS02295 | Protein ID | WP_003156187.1 |
Coordinates | 464488..464838 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | BAMMD1_RS02290 | Protein ID | WP_003156188.1 |
Coordinates | 464201..464482 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BAMMD1_RS02270 | 460566..461165 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
BAMMD1_RS02275 | 461258..461623 | + | 366 | WP_057080627.1 | holo-ACP synthase | - |
BAMMD1_RS02280 | 461788..462795 | + | 1008 | WP_003156191.1 | outer membrane lipoprotein carrier protein LolA | - |
BAMMD1_RS02285 | 462912..464081 | + | 1170 | WP_003156189.1 | alanine racemase | - |
BAMMD1_RS02290 | 464201..464482 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
BAMMD1_RS02295 | 464488..464838 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
BAMMD1_RS02300 | 464956..465777 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
BAMMD1_RS02305 | 465782..466147 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
BAMMD1_RS02310 | 466150..466551 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
BAMMD1_RS02315 | 466563..467570 | + | 1008 | WP_003156177.1 | PP2C family protein-serine/threonine phosphatase | - |
BAMMD1_RS02320 | 467634..467963 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
BAMMD1_RS02325 | 467960..468442 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
BAMMD1_RS02330 | 468408..469196 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
BAMMD1_RS02335 | 469196..469798 | + | 603 | WP_003156170.1 | SpoIIE family protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T285808 WP_003156187.1 NZ_LN999829:464488-464838 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|