Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN-AbrB
Location 1285306..1285937 Replicon chromosome
Accession NZ_LN999010
Organism Thermococcus chitonophagus isolate

Toxin (Protein)


Gene name vapC Uniprot ID A0A161KEJ7
Locus tag CHITON_RS06790 Protein ID WP_068577956.1
Coordinates 1285306..1285713 (-) Length 136 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A160VTP4
Locus tag CHITON_RS06795 Protein ID WP_068577958.1
Coordinates 1285701..1285937 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CHITON_RS06760 (CHITON_1354) 1280471..1281463 + 993 WP_068577950.1 hypothetical protein -
CHITON_RS06765 (CHITON_1355) 1281432..1282184 - 753 WP_068577952.1 hypothetical protein -
CHITON_RS06775 (CHITON_1356) 1282673..1283935 - 1263 WP_068577954.1 ATP-binding protein -
CHITON_RS11430 (CHITON_1357) 1283991..1284173 - 183 WP_231963761.1 hypothetical protein -
CHITON_RS11435 (CHITON_1358) 1284567..1284755 - 189 WP_231963762.1 hypothetical protein -
CHITON_RS06790 (CHITON_1359) 1285306..1285713 - 408 WP_068577956.1 PIN domain-containing protein Toxin
CHITON_RS06795 (CHITON_1360) 1285701..1285937 - 237 WP_068577958.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
CHITON_RS06805 (CHITON_1362) 1286368..1286637 + 270 WP_068577963.1 hypothetical protein -
CHITON_RS06810 (CHITON_1363) 1286634..1286975 - 342 WP_068577965.1 cupin domain-containing protein -
CHITON_RS06820 (CHITON_1364) 1287294..1287500 - 207 WP_068577968.1 hypothetical protein -
CHITON_RS06825 (CHITON_1365) 1287658..1288383 - 726 WP_068577970.1 tRNA-binding protein -
CHITON_RS11220 1288467..1288738 + 272 Protein_1371 4Fe-4S dicluster domain-containing protein -
CHITON_RS11275 1288712..1290226 + 1515 Protein_1372 aldehyde ferredoxin oxidoreductase -
CHITON_RS06835 (CHITON_1370) 1290296..1290550 + 255 WP_068577972.1 MoaD/ThiS family protein -
CHITON_RS06840 (CHITON_1371) 1290531..1290866 - 336 WP_068577975.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-124)

Antitoxin

SpoVT-AbrB domain

(3-44)


Sequences

Toxin        


Download         Length: 136 a.a.        Molecular weight: 15568.29 Da        Isoelectric Point: 9.8636

>T285806 WP_068577956.1 NZ_LN999010:c1285713-1285306 [Thermococcus chitonophagus]
MGSLAVIDTNVLIYSINKRSERYREARKILESLDELIIPVVVVYEFIWNLAEFGISSKVAKDVLSRILLDPRVKLVDDRK
HLLPTFEKLGGLSLRHYNDSMILRVAEEFGTLATYDRKLRKRAKKLGIDLLPENI

Download         Length: 408 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 9071.51 Da        Isoelectric Point: 5.1972

>AT285806 WP_068577958.1 NZ_LN999010:c1285937-1285701 [Thermococcus chitonophagus]
MPITKVTRNYQITIPAEIRKALGIKMGEYLKVELRGDEIVIKRIDKEWPSIDLGRDFSPEDIEENIRKALSEASKWEV

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A161KEJ7

Antitoxin

Source ID Structure
AlphaFold DB A0A160VTP4

References