Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 396403..397000 | Replicon | chromosome |
| Accession | NZ_LN999010 | ||
| Organism | Thermococcus chitonophagus isolate | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | CHITON_RS02150 | Protein ID | WP_084448844.1 |
| Coordinates | 396403..396792 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A160VU82 |
| Locus tag | CHITON_RS02155 | Protein ID | WP_068576321.1 |
| Coordinates | 396779..397000 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CHITON_RS02130 (CHITON_0427) | 391960..393240 | + | 1281 | Protein_431 | argininosuccinate lyase | - |
| CHITON_RS02135 (CHITON_0428) | 393249..394073 | + | 825 | WP_068576315.1 | lysine biosynthesis protein LysX | - |
| CHITON_RS02140 (CHITON_0429) | 394070..395674 | - | 1605 | WP_068576317.1 | radical SAM protein | - |
| CHITON_RS02145 (CHITON_0430) | 395814..396434 | + | 621 | WP_068576318.1 | METTL5 family protein | - |
| CHITON_RS02150 (CHITON_0431) | 396403..396792 | - | 390 | WP_084448844.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| CHITON_RS02155 (CHITON_0432) | 396779..397000 | - | 222 | WP_068576321.1 | hypothetical protein | Antitoxin |
| CHITON_RS02160 (CHITON_0433) | 397042..399369 | - | 2328 | WP_068576323.1 | DNA polymerase | - |
| CHITON_RS02165 (CHITON_0434) | 399464..400276 | + | 813 | WP_068576325.1 | MBL fold metallo-hydrolase | - |
| CHITON_RS02170 (CHITON_0435) | 400273..401013 | - | 741 | WP_068576327.1 | ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14595.96 Da Isoelectric Point: 4.7712
>T285805 WP_084448844.1 NZ_LN999010:c396792-396403 [Thermococcus chitonophagus]
VIVIDASALVMVVLQEPGWEKVPIGSEVATLDYAYVEGMNAIWKAVRWRELTREQGRMKITVLRMMKSSITTYRTEDFFE
RGLEIALDEGIAVYDAFYIALAESLDAKLVTADEKQYKAAKNYVPAKLV
VIVIDASALVMVVLQEPGWEKVPIGSEVATLDYAYVEGMNAIWKAVRWRELTREQGRMKITVLRMMKSSITTYRTEDFFE
RGLEIALDEGIAVYDAFYIALAESLDAKLVTADEKQYKAAKNYVPAKLV
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|