Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 180163..180983 | Replicon | chromosome |
| Accession | NZ_LN997848 | ||
| Organism | Magnetospirillum sp. XM-1 isolate XM1 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | XM1_RS22955 | Protein ID | WP_082700309.1 |
| Coordinates | 180163..180678 (-) | Length | 172 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | A0A0U5MDB5 |
| Locus tag | XM1_RS00895 | Protein ID | WP_068428319.1 |
| Coordinates | 180687..180983 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| XM1_RS00875 | 176112..177017 | + | 906 | WP_068428311.1 | U32 family peptidase | - |
| XM1_RS00880 | 177129..178139 | + | 1011 | WP_068428314.1 | hypothetical protein | - |
| XM1_RS00890 | 178502..179926 | + | 1425 | WP_156428601.1 | site-specific integrase | - |
| XM1_RS22955 | 180163..180678 | - | 516 | WP_082700309.1 | GNAT family N-acetyltransferase | Toxin |
| XM1_RS00895 | 180687..180983 | - | 297 | WP_068428319.1 | DUF1778 domain-containing protein | Antitoxin |
| XM1_RS23785 | 180986..181591 | - | 606 | WP_156428602.1 | hypothetical protein | - |
| XM1_RS00905 | 182000..182350 | + | 351 | WP_068428324.1 | hypothetical protein | - |
| XM1_RS00910 | 182363..182998 | - | 636 | WP_068428327.1 | recombinase family protein | - |
| XM1_RS23790 | 183104..183391 | + | 288 | WP_156428603.1 | hypothetical protein | - |
| XM1_RS00915 | 183943..184200 | + | 258 | WP_068428329.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 172 a.a. Molecular weight: 18103.92 Da Isoelectric Point: 9.2825
>T285803 WP_082700309.1 NZ_LN997848:c180678-180163 [Magnetospirillum sp. XM-1]
MALSAPEPLNAGHDVSQFSCGKPALDHWLKTRALSNQERGFTVVMVVHDAGRVIGYYGLAPTAVLPTAMPRSIKTGQPPN
PVPCLLLGQLATDQGWAGQGIGTGLLAHALTRCVQGAKLIGGRALIVNAIDPDAASFWRRRGFLPSKDDQLVLFRSIADI
AASLDAGEVRK
MALSAPEPLNAGHDVSQFSCGKPALDHWLKTRALSNQERGFTVVMVVHDAGRVIGYYGLAPTAVLPTAMPRSIKTGQPPN
PVPCLLLGQLATDQGWAGQGIGTGLLAHALTRCVQGAKLIGGRALIVNAIDPDAASFWRRRGFLPSKDDQLVLFRSIADI
AASLDAGEVRK
Download Length: 516 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|