Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 3466447..3467100 | Replicon | chromosome |
| Accession | NZ_LN997846 | ||
| Organism | Acinetobacter baumannii isolate R2091 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A3R9G864 |
| Locus tag | ABR2091_RS16110 | Protein ID | WP_000607075.1 |
| Coordinates | 3466447..3466836 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | ABR2091_RS16115 | Protein ID | WP_001288210.1 |
| Coordinates | 3466843..3467100 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABR2091_RS16095 | 3461565..3463760 | - | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
| ABR2091_RS16100 | 3463948..3464514 | - | 567 | WP_000651536.1 | rhombosortase | - |
| ABR2091_RS16105 | 3464592..3465677 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
| ABR2091_RS16110 | 3466447..3466836 | - | 390 | WP_000607075.1 | membrane protein | Toxin |
| ABR2091_RS16115 | 3466843..3467100 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| ABR2091_RS16120 | 3467288..3468460 | + | 1173 | WP_032028213.1 | acyl-CoA dehydrogenase family protein | - |
| ABR2091_RS16125 | 3468509..3469999 | - | 1491 | WP_031966421.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| ABR2091_RS16130 | 3470181..3470558 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| ABR2091_RS16135 | 3470577..3471584 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15649.94 Da Isoelectric Point: 10.3890
>T285801 WP_000607075.1 NZ_LN997846:c3466836-3466447 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKVIDYQIFIVIYFEGHKTLTSIIWFDQMSLVEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKVIDYQIFIVIYFEGHKTLTSIIWFDQMSLVEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3R9G864 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BQM7 |