Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-YefM |
Location | 2110280..2110995 | Replicon | chromosome |
Accession | NZ_LN908249 | ||
Organism | Actinobacillus pleuropneumoniae serovar 8 isolate MIDG2331 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | MIDG2331_RS10025 | Protein ID | WP_039709408.1 |
Coordinates | 2110280..2110708 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | B0BT01 |
Locus tag | MIDG2331_RS10030 | Protein ID | WP_005599447.1 |
Coordinates | 2110708..2110995 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MIDG2331_RS10010 | 2105865..2107571 | - | 1707 | WP_005609259.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
MIDG2331_RS10015 | 2107667..2107948 | - | 282 | WP_012263402.1 | DNA-directed RNA polymerase subunit omega | - |
MIDG2331_RS10020 | 2108075..2110156 | - | 2082 | WP_039709407.1 | ATP-dependent DNA helicase RecG | - |
MIDG2331_RS10025 | 2110280..2110708 | - | 429 | WP_039709408.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MIDG2331_RS10030 | 2110708..2110995 | - | 288 | WP_005599447.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
MIDG2331_RS10035 | 2111201..2112916 | + | 1716 | WP_039709409.1 | proline--tRNA ligase | - |
MIDG2331_RS10040 | 2112982..2113170 | - | 189 | WP_005602684.1 | hypothetical protein | - |
MIDG2331_RS10045 | 2113173..2113754 | - | 582 | WP_005606496.1 | sigma-70 family RNA polymerase sigma factor | - |
MIDG2331_RS10050 | 2113843..2114799 | + | 957 | WP_005619040.1 | protein-methionine-sulfoxide reductase catalytic subunit MsrP | - |
MIDG2331_RS10055 | 2114799..2115392 | + | 594 | WP_005599453.1 | sulfoxide reductase heme-binding subunit YedZ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 16549.96 Da Isoelectric Point: 7.8935
>T285800 WP_039709408.1 NZ_LN908249:c2110708-2110280 [Actinobacillus pleuropneumoniae serovar 8]
MFQYLFDTNIISELYKLGNSRIDTNVRQWLETIKPSQTNISCITLSEIKTGILLKARKDPIQAERLNHWFTHDVLSVYQA
KSFSINNEIALLASEYHIPNKMDLNDAYIAATAKYHNLVLVTRNLKDFNRCDIRLFNPFEPN
MFQYLFDTNIISELYKLGNSRIDTNVRQWLETIKPSQTNISCITLSEIKTGILLKARKDPIQAERLNHWFTHDVLSVYQA
KSFSINNEIALLASEYHIPNKMDLNDAYIAATAKYHNLVLVTRNLKDFNRCDIRLFNPFEPN
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|