Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2014453..2015081 | Replicon | chromosome |
Accession | NZ_LN908249 | ||
Organism | Actinobacillus pleuropneumoniae serovar 8 isolate MIDG2331 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | MIDG2331_RS09440 | Protein ID | WP_005609156.1 |
Coordinates | 2014683..2015081 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | MIDG2331_RS09435 | Protein ID | WP_039709385.1 |
Coordinates | 2014453..2014683 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MIDG2331_RS09430 | 2012302..2013933 | + | 1632 | WP_005613299.1 | hypothetical protein | - |
MIDG2331_RS11540 | 2014205..2014345 | - | 141 | WP_162835170.1 | hypothetical protein | - |
MIDG2331_RS09435 | 2014453..2014683 | + | 231 | WP_039709385.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
MIDG2331_RS09440 | 2014683..2015081 | + | 399 | WP_005609156.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
MIDG2331_RS09445 | 2015216..2015632 | - | 417 | WP_005609158.1 | DUF417 family protein | - |
MIDG2331_RS09450 | 2015879..2016529 | + | 651 | WP_039709386.1 | DUF2202 domain-containing protein | - |
MIDG2331_RS09455 | 2016604..2017263 | - | 660 | WP_039709387.1 | hypothetical protein | - |
MIDG2331_RS11545 | 2017509..2017670 | - | 162 | WP_160260668.1 | hypothetical protein | - |
MIDG2331_RS09460 | 2017663..2018334 | - | 672 | WP_039709388.1 | hypothetical protein | - |
MIDG2331_RS09465 | 2018406..2019728 | - | 1323 | WP_039709389.1 | HslU--HslV peptidase ATPase subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1998958..2030905 | 31947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15066.37 Da Isoelectric Point: 7.3824
>T285799 WP_005609156.1 NZ_LN908249:2014683-2015081 [Actinobacillus pleuropneumoniae serovar 8]
MLTYMLDTNIAIYVIKRRPIEVLDKFNLNSTRLCVSSITAAELYYGAEKSQFPERNMAVIEDFLSRLTILDYTHKAATHF
GNIKAHLSKCGKILGENDIHIAAHARSEGLVLVTNNLREFERVEGLRLDNWV
MLTYMLDTNIAIYVIKRRPIEVLDKFNLNSTRLCVSSITAAELYYGAEKSQFPERNMAVIEDFLSRLTILDYTHKAATHF
GNIKAHLSKCGKILGENDIHIAAHARSEGLVLVTNNLREFERVEGLRLDNWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|