Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1796808..1797539 | Replicon | chromosome |
Accession | NZ_LN908249 | ||
Organism | Actinobacillus pleuropneumoniae serovar 8 isolate MIDG2331 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | MIDG2331_RS08365 | Protein ID | WP_005598840.1 |
Coordinates | 1796808..1797275 (-) | Length | 156 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | B0BRD3 |
Locus tag | MIDG2331_RS08370 | Protein ID | WP_005619269.1 |
Coordinates | 1797279..1797539 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MIDG2331_RS08340 | 1792168..1792539 | - | 372 | WP_005598830.1 | CrcB family protein | - |
MIDG2331_RS08345 | 1792542..1793606 | - | 1065 | WP_039709309.1 | MFS transporter | - |
MIDG2331_RS08350 | 1793701..1794810 | + | 1110 | WP_039709310.1 | anhydro-N-acetylmuramic acid kinase | - |
MIDG2331_RS08355 | 1794863..1795777 | + | 915 | WP_005598836.1 | N-acetylmuramic acid 6-phosphate etherase | - |
MIDG2331_RS08360 | 1795844..1796725 | - | 882 | WP_005598838.1 | 50S ribosomal protein L11 methyltransferase | - |
MIDG2331_RS08365 | 1796808..1797275 | - | 468 | WP_005598840.1 | GNAT family N-acetyltransferase | Toxin |
MIDG2331_RS08370 | 1797279..1797539 | - | 261 | WP_005619269.1 | DUF1778 domain-containing protein | Antitoxin |
MIDG2331_RS08375 | 1797660..1799120 | - | 1461 | WP_039709592.1 | metalloprotease TldD | - |
MIDG2331_RS08380 | 1799250..1800509 | + | 1260 | WP_039709311.1 | tRNA lysidine(34) synthetase TilS | - |
MIDG2331_RS08385 | 1800536..1800826 | - | 291 | WP_005602215.1 | DUF5389 family protein | - |
MIDG2331_RS08390 | 1800828..1801721 | - | 894 | WP_005598850.1 | site-specific tyrosine recombinase XerD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 17206.22 Da Isoelectric Point: 8.9312
>T285798 WP_005598840.1 NZ_LN908249:c1797275-1796808 [Actinobacillus pleuropneumoniae serovar 8]
MHAPELLSEQHIVRYFQCGEVVLDQWLQRTALKNQQNNASKTFVVCDENKQVMGFYCLSAGSVSHQFVAGALRRNMPDPI
PVIILGRLAVDCSAQGKQLGVSMLKDAVLKSKTVANQIGIKALLVHALNPQAKQFYLKYGFSCSPIDEMVLMLKL
MHAPELLSEQHIVRYFQCGEVVLDQWLQRTALKNQQNNASKTFVVCDENKQVMGFYCLSAGSVSHQFVAGALRRNMPDPI
PVIILGRLAVDCSAQGKQLGVSMLKDAVLKSKTVANQIGIKALLVHALNPQAKQFYLKYGFSCSPIDEMVLMLKL
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|