Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | toxTA/Tad-couple_hipB |
Location | 1590235..1590880 | Replicon | chromosome |
Accession | NZ_LN908249 | ||
Organism | Actinobacillus pleuropneumoniae serovar 8 isolate MIDG2331 |
Toxin (Protein)
Gene name | toxT | Uniprot ID | B0BQU7 |
Locus tag | MIDG2331_RS07360 | Protein ID | WP_005619674.1 |
Coordinates | 1590509..1590880 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | MIDG2331_RS07355 | Protein ID | WP_005598477.1 |
Coordinates | 1590235..1590528 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MIDG2331_RS07325 | 1585567..1586250 | - | 684 | WP_005601946.1 | arginine ABC transporter permease ArtM | - |
MIDG2331_RS07330 | 1586250..1586921 | - | 672 | WP_005601949.1 | arginine ABC transporter permease ArtQ | - |
MIDG2331_RS07335 | 1586927..1587661 | - | 735 | WP_005601951.1 | transporter substrate-binding domain-containing protein | - |
MIDG2331_RS07340 | 1587666..1588400 | - | 735 | WP_005598473.1 | arginine ABC transporter ATP-binding protein ArtP | - |
MIDG2331_RS07345 | 1588625..1589122 | - | 498 | WP_005601953.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
MIDG2331_RS07350 | 1589195..1590157 | + | 963 | WP_005619672.1 | calcium/sodium antiporter | - |
MIDG2331_RS07355 | 1590235..1590528 | - | 294 | WP_005598477.1 | helix-turn-helix domain-containing protein | Antitoxin |
MIDG2331_RS07360 | 1590509..1590880 | - | 372 | WP_005619674.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MIDG2331_RS07365 | 1591074..1592825 | + | 1752 | WP_039709264.1 | protein-disulfide reductase DsbD | - |
MIDG2331_RS07370 | 1592883..1593452 | + | 570 | WP_005608594.1 | elongation factor P hydroxylase | - |
MIDG2331_RS07375 | 1593496..1594350 | - | 855 | WP_005598486.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 15066.57 Da Isoelectric Point: 10.4054
>T285797 WP_005619674.1 NZ_LN908249:c1590880-1590509 [Actinobacillus pleuropneumoniae serovar 8]
MYEIVFYRDKRGREPVKEFLLRLLKERQEGSRERLHKISHHLSILHLHGTRAGENYIKHLEDRIWQLRPVGDCLLFASII
RGKFVLLHYFAKQNYRIPKREIERAKVRLADLQERIKDEPYWF
MYEIVFYRDKRGREPVKEFLLRLLKERQEGSRERLHKISHHLSILHLHGTRAGENYIKHLEDRIWQLRPVGDCLLFASII
RGKFVLLHYFAKQNYRIPKREIERAKVRLADLQERIKDEPYWF
Download Length: 372 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10935.81 Da Isoelectric Point: 10.3120
>AT285797 WP_005598477.1 NZ_LN908249:c1590528-1590235 [Actinobacillus pleuropneumoniae serovar 8]
MSPIGSSWTSFEQEIFDESEIAETQFRIRLILEIIETRQQLGISQRKLEKLSGVKQSMIARVEKGSVNPSLATVLKLLVP
LGKTLQIVPLDKNKTVR
MSPIGSSWTSFEQEIFDESEIAETQFRIRLILEIIETRQQLGISQRKLEKLSGVKQSMIARVEKGSVNPSLATVLKLLVP
LGKTLQIVPLDKNKTVR
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|