Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YoeB-YefM
Location 1440179..1440687 Replicon chromosome
Accession NZ_LN908249
Organism Actinobacillus pleuropneumoniae serovar 8 isolate MIDG2331

Toxin (Protein)


Gene name relE Uniprot ID B0BQK9
Locus tag MIDG2331_RS06545 Protein ID WP_005605064.1
Coordinates 1440427..1440687 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID B0BQK8
Locus tag MIDG2331_RS06540 Protein ID WP_005598318.1
Coordinates 1440179..1440430 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MIDG2331_RS06515 1435353..1436015 + 663 WP_052250595.1 ash family protein -
MIDG2331_RS06520 1436008..1436349 + 342 WP_014991324.1 hypothetical protein -
MIDG2331_RS06525 1436342..1436545 + 204 WP_039768150.1 hypothetical protein -
MIDG2331_RS06530 1436538..1436762 + 225 WP_014991326.1 hypothetical protein -
MIDG2331_RS06535 1436740..1438911 + 2172 WP_039768152.1 DUF927 domain-containing protein -
MIDG2331_RS11445 1439390..1439482 + 93 WP_171823683.1 type II toxin-antitoxin system HigB family toxin -
MIDG2331_RS06540 1440179..1440430 + 252 WP_005598318.1 YoeB-YefM toxin-antitoxin system antitoxin YefM Antitoxin
MIDG2331_RS06545 1440427..1440687 + 261 WP_005605064.1 Txe/YoeB family addiction module toxin Toxin
MIDG2331_RS06550 1440846..1441013 - 168 WP_005598320.1 Trm112 family protein -
MIDG2331_RS06555 1441015..1441995 - 981 WP_005608502.1 tetraacyldisaccharide 4'-kinase -
MIDG2331_RS06560 1442089..1443347 - 1259 Protein_1279 ATP-dependent protease ATP-binding subunit ClpX -
MIDG2331_RS06565 1443347..1443937 - 591 WP_005598326.1 ATP-dependent Clp endopeptidase proteolytic subunit ClpP -
MIDG2331_RS06570 1444059..1444451 + 393 WP_005620423.1 SufE family protein -
MIDG2331_RS06585 1444822..1445583 - 762 WP_039709246.1 DNA polymerase III subunit epsilon -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-73)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 10423.99 Da        Isoelectric Point: 8.0109

>T285796 WP_005605064.1 NZ_LN908249:1440427-1440687 [Actinobacillus pleuropneumoniae serovar 8]
MKLTFSSNAWEDYLYWQKTDKIILKRINSLIKDIQRQPFEGIGKLEPLKFNLSGFWSRRINEEHRLIYSVEDEAILIVAC
RYHYDQ

Download         Length: 261 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9362.66 Da        Isoelectric Point: 4.5659

>AT285796 WP_005598318.1 NZ_LN908249:1440179-1440430 [Actinobacillus pleuropneumoniae serovar 8]
MQAITYTEARQNLAGTMSKVAEDFEPILITRSKGGNCVLMSYEQYCSLEETAYLMRSPTNAKRLLDSVAELRQGQGIERE
LIE

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB B0BQK9

Antitoxin

Source ID Structure
AlphaFold DB B0BQK8

References