Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YoeB-YefM |
| Location | 1440179..1440687 | Replicon | chromosome |
| Accession | NZ_LN908249 | ||
| Organism | Actinobacillus pleuropneumoniae serovar 8 isolate MIDG2331 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | B0BQK9 |
| Locus tag | MIDG2331_RS06545 | Protein ID | WP_005605064.1 |
| Coordinates | 1440427..1440687 (+) | Length | 87 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | B0BQK8 |
| Locus tag | MIDG2331_RS06540 | Protein ID | WP_005598318.1 |
| Coordinates | 1440179..1440430 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MIDG2331_RS06515 | 1435353..1436015 | + | 663 | WP_052250595.1 | ash family protein | - |
| MIDG2331_RS06520 | 1436008..1436349 | + | 342 | WP_014991324.1 | hypothetical protein | - |
| MIDG2331_RS06525 | 1436342..1436545 | + | 204 | WP_039768150.1 | hypothetical protein | - |
| MIDG2331_RS06530 | 1436538..1436762 | + | 225 | WP_014991326.1 | hypothetical protein | - |
| MIDG2331_RS06535 | 1436740..1438911 | + | 2172 | WP_039768152.1 | DUF927 domain-containing protein | - |
| MIDG2331_RS11445 | 1439390..1439482 | + | 93 | WP_171823683.1 | type II toxin-antitoxin system HigB family toxin | - |
| MIDG2331_RS06540 | 1440179..1440430 | + | 252 | WP_005598318.1 | YoeB-YefM toxin-antitoxin system antitoxin YefM | Antitoxin |
| MIDG2331_RS06545 | 1440427..1440687 | + | 261 | WP_005605064.1 | Txe/YoeB family addiction module toxin | Toxin |
| MIDG2331_RS06550 | 1440846..1441013 | - | 168 | WP_005598320.1 | Trm112 family protein | - |
| MIDG2331_RS06555 | 1441015..1441995 | - | 981 | WP_005608502.1 | tetraacyldisaccharide 4'-kinase | - |
| MIDG2331_RS06560 | 1442089..1443347 | - | 1259 | Protein_1279 | ATP-dependent protease ATP-binding subunit ClpX | - |
| MIDG2331_RS06565 | 1443347..1443937 | - | 591 | WP_005598326.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | - |
| MIDG2331_RS06570 | 1444059..1444451 | + | 393 | WP_005620423.1 | SufE family protein | - |
| MIDG2331_RS06585 | 1444822..1445583 | - | 762 | WP_039709246.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10423.99 Da Isoelectric Point: 8.0109
>T285796 WP_005605064.1 NZ_LN908249:1440427-1440687 [Actinobacillus pleuropneumoniae serovar 8]
MKLTFSSNAWEDYLYWQKTDKIILKRINSLIKDIQRQPFEGIGKLEPLKFNLSGFWSRRINEEHRLIYSVEDEAILIVAC
RYHYDQ
MKLTFSSNAWEDYLYWQKTDKIILKRINSLIKDIQRQPFEGIGKLEPLKFNLSGFWSRRINEEHRLIYSVEDEAILIVAC
RYHYDQ
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|