Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-MazE |
| Location | 729866..730516 | Replicon | chromosome |
| Accession | NZ_LN908249 | ||
| Organism | Actinobacillus pleuropneumoniae serovar 8 isolate MIDG2331 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | B0BNU3 |
| Locus tag | MIDG2331_RS03310 | Protein ID | WP_005614926.1 |
| Coordinates | 729866..730255 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | B0BNU4 |
| Locus tag | MIDG2331_RS03315 | Protein ID | WP_005604117.1 |
| Coordinates | 730256..730516 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MIDG2331_RS03295 | 725442..726632 | + | 1191 | WP_171823688.1 | aromatic amino acid transaminase | - |
| MIDG2331_RS03300 | 726812..728098 | - | 1287 | WP_009874699.1 | Xaa-Pro aminopeptidase | - |
| MIDG2331_RS03305 | 728507..729730 | - | 1224 | WP_039709068.1 | ATP-binding protein | - |
| MIDG2331_RS03310 | 729866..730255 | - | 390 | WP_005614926.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MIDG2331_RS03315 | 730256..730516 | - | 261 | WP_005604117.1 | hypothetical protein | Antitoxin |
| MIDG2331_RS03320 | 730650..732671 | - | 2022 | WP_058230468.1 | excinuclease ABC subunit B | - |
| MIDG2331_RS03325 | 732848..733660 | + | 813 | WP_039709069.1 | EfeM/EfeO family lipoprotein | - |
| MIDG2331_RS03330 | 733672..734865 | + | 1194 | WP_005604123.1 | deferrochelatase/peroxidase EfeB | - |
| MIDG2331_RS03335 | 734876..735496 | + | 621 | WP_039709071.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14837.17 Da Isoelectric Point: 5.1295
>T285795 WP_005614926.1 NZ_LN908249:c730255-729866 [Actinobacillus pleuropneumoniae serovar 8]
MYMLDTNTVSYFFRQDPTVVKKLQQLNPELICISSVTAAELFYGVKKRNNQKLTAFLNTFLSAITVMDWDYQVAEVYGQL
RAEMEREGKIMGVQDQMIGAHALATECVLVSSDKAFQFIPNLVLENWWK
MYMLDTNTVSYFFRQDPTVVKKLQQLNPELICISSVTAAELFYGVKKRNNQKLTAFLNTFLSAITVMDWDYQVAEVYGQL
RAEMEREGKIMGVQDQMIGAHALATECVLVSSDKAFQFIPNLVLENWWK
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|