Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbE-relB/ParE-YafN |
Location | 747428..747956 | Replicon | chromosome |
Accession | NZ_LN907867 | ||
Organism | Blastochloris viridis isolate |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A0H5BJ02 |
Locus tag | BVIRIDIS_RS03200 | Protein ID | WP_055036861.1 |
Coordinates | 747666..747956 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0H5BFZ2 |
Locus tag | BVIRIDIS_RS03195 | Protein ID | WP_055036860.1 |
Coordinates | 747428..747676 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BVIRIDIS_RS03165 | 742448..744700 | - | 2253 | WP_055036854.1 | phage tail length tape measure family protein | - |
BVIRIDIS_RS03170 | 744705..744929 | - | 225 | WP_055036855.1 | hypothetical protein | - |
BVIRIDIS_RS03175 | 744926..745366 | - | 441 | WP_055036856.1 | hypothetical protein | - |
BVIRIDIS_RS17065 | 746617..746892 | - | 276 | Protein_651 | hypothetical protein | - |
BVIRIDIS_RS03190 | 746909..747343 | - | 435 | WP_055036859.1 | hypothetical protein | - |
BVIRIDIS_RS03195 | 747428..747676 | + | 249 | WP_055036860.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
BVIRIDIS_RS03200 | 747666..747956 | + | 291 | WP_055036861.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
BVIRIDIS_RS03205 | 747964..748593 | - | 630 | WP_055036862.1 | hypothetical protein | - |
BVIRIDIS_RS03210 | 748595..748909 | - | 315 | WP_055036863.1 | hypothetical protein | - |
BVIRIDIS_RS03215 | 748906..749244 | - | 339 | WP_055036864.1 | DUF2190 family protein | - |
BVIRIDIS_RS03220 | 749329..751287 | - | 1959 | WP_055036865.1 | HK97 family phage prohead protease | - |
BVIRIDIS_RS03225 | 751305..752831 | - | 1527 | WP_055036866.1 | phage portal protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 725720..790681 | 64961 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11310.14 Da Isoelectric Point: 10.3633
>T285794 WP_055036861.1 NZ_LN907867:747666-747956 [Blastochloris viridis]
MSYELAFLDEALKEWRKLDSTMRDQFKAKLAERLENPNIPSARLHGAKERYKIKLRSAGYRLVYEVRDLELLVLVVAVGK
RERNEIYKTAARRKAD
MSYELAFLDEALKEWRKLDSTMRDQFKAKLAERLENPNIPSARLHGAKERYKIKLRSAGYRLVYEVRDLELLVLVVAVGK
RERNEIYKTAARRKAD
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H5BJ02 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H5BFZ2 |