Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 244656..245299 | Replicon | plasmid pEM01 |
| Accession | NZ_LN907828 | ||
| Organism | Erwinia gerundensis isolate E_g_EM595 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A0U5L9X5 |
| Locus tag | EM595_RS18320 | Protein ID | WP_067436186.1 |
| Coordinates | 244883..245299 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A0U5GSS6 |
| Locus tag | EM595_RS18315 | Protein ID | WP_067436183.1 |
| Coordinates | 244656..244886 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EM595_RS18290 | 240405..240962 | - | 558 | WP_067436169.1 | hypothetical protein | - |
| EM595_RS18295 | 241029..241313 | - | 285 | WP_067436172.1 | YkgJ family cysteine cluster protein | - |
| EM595_RS18300 | 241310..242887 | - | 1578 | WP_067436174.1 | cobalamin adenosyltransferase | - |
| EM595_RS18305 | 242901..243986 | - | 1086 | WP_067436177.1 | chemotaxis protein | - |
| EM595_RS18315 | 244656..244886 | + | 231 | WP_067436183.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| EM595_RS18320 | 244883..245299 | + | 417 | WP_067436186.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| EM595_RS18325 | 245819..246898 | + | 1080 | WP_067436189.1 | mechanosensitive ion channel family protein | - |
| EM595_RS18330 | 247323..248228 | - | 906 | WP_067436192.1 | LysR family transcriptional regulator | - |
| EM595_RS18335 | 248399..249454 | + | 1056 | WP_067436195.1 | aldo/keto reductase | - |
| EM595_RS18340 | 249533..249826 | + | 294 | WP_067436198.1 | DUF1330 domain-containing protein | - |
| EM595_RS21200 | 250161..250250 | + | 90 | WP_157883936.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | iucC / iutA | 1..571293 | 571293 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15248.71 Da Isoelectric Point: 6.4720
>T285790 WP_067436186.1 NZ_LN907828:244883-245299 [Erwinia gerundensis]
VNKTFMLDTNICSFIMREQPEAVIRRLVQTVLHNHRIVVSAITYAEMRFGTINKKASPRHAQMVDAFCARLDSILPWDQT
AVDATMEIKAALATLGTPIGPNDTAIAGHAIAVQAILVTNNIREFEGVCGLMLEDWVN
VNKTFMLDTNICSFIMREQPEAVIRRLVQTVLHNHRIVVSAITYAEMRFGTINKKASPRHAQMVDAFCARLDSILPWDQT
AVDATMEIKAALATLGTPIGPNDTAIAGHAIAVQAILVTNNIREFEGVCGLMLEDWVN
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0U5L9X5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0U5GSS6 |