Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 2293608..2294149 | Replicon | chromosome |
Accession | NZ_LN907827 | ||
Organism | Erwinia gerundensis isolate E_g_EM595 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0U5L7E3 |
Locus tag | EM595_RS10700 | Protein ID | WP_067431537.1 |
Coordinates | 2293862..2294149 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0U5L6M5 |
Locus tag | EM595_RS10695 | Protein ID | WP_067431534.1 |
Coordinates | 2293608..2293856 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EM595_RS10675 | 2288709..2289287 | - | 579 | WP_067431528.1 | flagellar transcriptional regulator FlhC | - |
EM595_RS10680 | 2289284..2289640 | - | 357 | WP_067431531.1 | flagellar transcriptional regulator FlhD | - |
EM595_RS10685 | 2290707..2292143 | - | 1437 | WP_067431533.1 | alpha,alpha-trehalose-phosphate synthase | - |
EM595_RS10690 | 2292148..2292921 | - | 774 | WP_157883920.1 | trehalose-phosphatase | - |
EM595_RS10695 | 2293608..2293856 | + | 249 | WP_067431534.1 | antitoxin | Antitoxin |
EM595_RS10700 | 2293862..2294149 | + | 288 | WP_067431537.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EM595_RS10705 | 2294178..2295437 | - | 1260 | WP_067431540.1 | translesion error-prone DNA polymerase V subunit UmuC | - |
EM595_RS10710 | 2295912..2296586 | - | 675 | WP_067431543.1 | hypothetical protein | - |
EM595_RS10715 | 2296804..2297211 | - | 408 | WP_173645372.1 | DNA polymerase V subunit UmuD | - |
EM595_RS10720 | 2297513..2298592 | - | 1080 | WP_067431546.1 | two-component system sensor histidine kinase PmrB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10968.00 Da Isoelectric Point: 10.5498
>T285789 WP_067431537.1 NZ_LN907827:2293862-2294149 [Erwinia gerundensis]
MGYTIKIREEALKEWNGLDSIIREQFKKKLKKPPENPHIPAARLAGMPDCYKIKLRASGFRLVYQVMDDVLIVAVVAVGK
RERSQPYKLASERLR
MGYTIKIREEALKEWNGLDSIIREQFKKKLKKPPENPHIPAARLAGMPDCYKIKLRASGFRLVYQVMDDVLIVAVVAVGK
RERSQPYKLASERLR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0U5L7E3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0U5L6M5 |