Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1093722..1094347 | Replicon | chromosome |
| Accession | NZ_LN907827 | ||
| Organism | Erwinia gerundensis isolate E_g_EM595 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A0U5L254 |
| Locus tag | EM595_RS04940 | Protein ID | WP_067428457.1 |
| Coordinates | 1093722..1093940 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | EM595_RS04945 | Protein ID | WP_067428460.1 |
| Coordinates | 1093973..1094347 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EM595_RS04910 | 1089684..1090022 | + | 339 | WP_067428451.1 | P-II family nitrogen regulator | - |
| EM595_RS04915 | 1090052..1091341 | + | 1290 | WP_067435167.1 | ammonium transporter AmtB | - |
| EM595_RS04920 | 1091403..1092266 | - | 864 | WP_067435170.1 | acyl-CoA thioesterase II | - |
| EM595_RS04925 | 1092457..1093014 | + | 558 | WP_067435173.1 | YbaY family lipoprotein | - |
| EM595_RS04930 | 1093041..1093391 | - | 351 | WP_071852487.1 | MGMT family protein | - |
| EM595_RS04940 | 1093722..1093940 | - | 219 | WP_067428457.1 | hemolysin expression modulator Hha | Toxin |
| EM595_RS04945 | 1093973..1094347 | - | 375 | WP_067428460.1 | Hha toxicity modulator TomB | Antitoxin |
| EM595_RS04950 | 1094496..1094849 | - | 354 | WP_067428462.1 | hypothetical protein | - |
| EM595_RS04955 | 1095196..1095873 | + | 678 | WP_067435176.1 | ABC transporter ATP-binding protein | - |
| EM595_RS04960 | 1095870..1096709 | + | 840 | WP_067435179.1 | metal ABC transporter permease | - |
| EM595_RS04965 | 1096726..1097604 | + | 879 | WP_067428464.1 | metal ABC transporter substrate-binding protein | - |
| EM595_RS20585 | 1097679..1097819 | - | 141 | WP_071852488.1 | type B 50S ribosomal protein L36 | - |
| EM595_RS04970 | 1097829..1098086 | - | 258 | WP_067428465.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.06 Da Isoelectric Point: 9.4825
>T285787 WP_067428457.1 NZ_LN907827:c1093940-1093722 [Erwinia gerundensis]
MSDKTLTKTDYLMRLRRCRSIDTLERVIEKNKYELPDNELAIFYSAADHRLAELTMNKLYDKVPVSVWKFVR
MSDKTLTKTDYLMRLRRCRSIDTLERVIEKNKYELPDNELAIFYSAADHRLAELTMNKLYDKVPVSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14474.08 Da Isoelectric Point: 4.5014
>AT285787 WP_067428460.1 NZ_LN907827:c1094347-1093973 [Erwinia gerundensis]
MDEYSPKRHDMAQLKYLCESLHDDSMATLSDSHHGWVNDPTSASNLQLNDLIEHIASFTMNYKIKHVEDEELITQIDEYL
DDTFMLFSNYGVSAQDLQRWQRSAKRLFNIFAEECALLQPSHSF
MDEYSPKRHDMAQLKYLCESLHDDSMATLSDSHHGWVNDPTSASNLQLNDLIEHIASFTMNYKIKHVEDEELITQIDEYL
DDTFMLFSNYGVSAQDLQRWQRSAKRLFNIFAEECALLQPSHSF
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|