Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1093722..1094347 Replicon chromosome
Accession NZ_LN907827
Organism Erwinia gerundensis isolate E_g_EM595

Toxin (Protein)


Gene name Hha Uniprot ID A0A0U5L254
Locus tag EM595_RS04940 Protein ID WP_067428457.1
Coordinates 1093722..1093940 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID -
Locus tag EM595_RS04945 Protein ID WP_067428460.1
Coordinates 1093973..1094347 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EM595_RS04910 1089684..1090022 + 339 WP_067428451.1 P-II family nitrogen regulator -
EM595_RS04915 1090052..1091341 + 1290 WP_067435167.1 ammonium transporter AmtB -
EM595_RS04920 1091403..1092266 - 864 WP_067435170.1 acyl-CoA thioesterase II -
EM595_RS04925 1092457..1093014 + 558 WP_067435173.1 YbaY family lipoprotein -
EM595_RS04930 1093041..1093391 - 351 WP_071852487.1 MGMT family protein -
EM595_RS04940 1093722..1093940 - 219 WP_067428457.1 hemolysin expression modulator Hha Toxin
EM595_RS04945 1093973..1094347 - 375 WP_067428460.1 Hha toxicity modulator TomB Antitoxin
EM595_RS04950 1094496..1094849 - 354 WP_067428462.1 hypothetical protein -
EM595_RS04955 1095196..1095873 + 678 WP_067435176.1 ABC transporter ATP-binding protein -
EM595_RS04960 1095870..1096709 + 840 WP_067435179.1 metal ABC transporter permease -
EM595_RS04965 1096726..1097604 + 879 WP_067428464.1 metal ABC transporter substrate-binding protein -
EM595_RS20585 1097679..1097819 - 141 WP_071852488.1 type B 50S ribosomal protein L36 -
EM595_RS04970 1097829..1098086 - 258 WP_067428465.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8640.06 Da        Isoelectric Point: 9.4825

>T285787 WP_067428457.1 NZ_LN907827:c1093940-1093722 [Erwinia gerundensis]
MSDKTLTKTDYLMRLRRCRSIDTLERVIEKNKYELPDNELAIFYSAADHRLAELTMNKLYDKVPVSVWKFVR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14474.08 Da        Isoelectric Point: 4.5014

>AT285787 WP_067428460.1 NZ_LN907827:c1094347-1093973 [Erwinia gerundensis]
MDEYSPKRHDMAQLKYLCESLHDDSMATLSDSHHGWVNDPTSASNLQLNDLIEHIASFTMNYKIKHVEDEELITQIDEYL
DDTFMLFSNYGVSAQDLQRWQRSAKRLFNIFAEECALLQPSHSF

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0U5L254

Antitoxin

Source ID Structure

References