Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 4278331..4278933 | Replicon | chromosome |
Accession | NZ_LN901633 | ||
Organism | Bradyrhizobium sp. isolate BF49_genome1 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | BN2626_RS20165 | Protein ID | WP_063994642.1 |
Coordinates | 4278634..4278933 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | H5YDN2 |
Locus tag | BN2626_RS20160 | Protein ID | WP_007605286.1 |
Coordinates | 4278331..4278630 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN2626_RS20140 | 4274233..4274664 | - | 432 | WP_007605278.1 | acyl-CoA thioesterase | - |
BN2626_RS20145 | 4274675..4275436 | - | 762 | WP_063994641.1 | SDR family NAD(P)-dependent oxidoreductase | - |
BN2626_RS20150 | 4275458..4277344 | - | 1887 | WP_007605283.1 | feruloyl-CoA synthase | - |
BN2626_RS20155 | 4277341..4278150 | - | 810 | WP_007605285.1 | crotonase/enoyl-CoA hydratase family protein | - |
BN2626_RS20160 | 4278331..4278630 | - | 300 | WP_007605286.1 | putative addiction module antidote protein | Antitoxin |
BN2626_RS20165 | 4278634..4278933 | - | 300 | WP_063994642.1 | addiction module protein | Toxin |
BN2626_RS20170 | 4279001..4279462 | - | 462 | WP_063994643.1 | DUF3237 domain-containing protein | - |
BN2626_RS20175 | 4279474..4280793 | - | 1320 | WP_007599671.1 | TRAP transporter permease | - |
BN2626_RS20180 | 4280796..4281305 | - | 510 | WP_007605289.1 | TRAP transporter small permease | - |
BN2626_RS20185 | 4281439..4282455 | - | 1017 | WP_063994644.1 | TRAP transporter substrate-binding protein | - |
BN2626_RS20190 | 4282670..4283839 | + | 1170 | WP_063994645.1 | 4-hydroxybenzoate 3-monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 10881.57 Da Isoelectric Point: 10.8536
>T285786 WP_063994642.1 NZ_LN901633:c4278933-4278634 [Bradyrhizobium sp.]
MPTIKRTDEFSDWLRNLRDRRAKAKILARIDRLALGNPGDVAPVGGGISEMRVHEGAGYRIYYVAPRARRSLFSFAGAIK
GSQPGDIALAKKIASELEV
MPTIKRTDEFSDWLRNLRDRRAKAKILARIDRLALGNPGDVAPVGGGISEMRVHEGAGYRIYYVAPRARRSLFSFAGAIK
GSQPGDIALAKKIASELEV
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|