Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 1108914..1109533 | Replicon | chromosome |
Accession | NZ_LN901633 | ||
Organism | Bradyrhizobium sp. isolate BF49_genome1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A160U8A9 |
Locus tag | BN2626_RS05235 | Protein ID | WP_063992768.1 |
Coordinates | 1109141..1109533 (+) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | BN2626_RS05230 | Protein ID | WP_035974028.1 |
Coordinates | 1108914..1109144 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN2626_RS05205 | 1103980..1104639 | + | 660 | WP_063992766.1 | hypothetical protein | - |
BN2626_RS05210 | 1104710..1105552 | + | 843 | WP_007609144.1 | metallophosphoesterase | - |
BN2626_RS05215 | 1105569..1105865 | - | 297 | WP_084777575.1 | hypothetical protein | - |
BN2626_RS05220 | 1106017..1107039 | - | 1023 | WP_007609140.1 | NADP-dependent oxidoreductase | - |
BN2626_RS05225 | 1107160..1108650 | - | 1491 | WP_007609139.1 | IMP dehydrogenase | - |
BN2626_RS05230 | 1108914..1109144 | + | 231 | WP_035974028.1 | hypothetical protein | Antitoxin |
BN2626_RS05235 | 1109141..1109533 | + | 393 | WP_063992768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
BN2626_RS05240 | 1109694..1111184 | + | 1491 | WP_063992769.1 | MFS transporter | - |
BN2626_RS05245 | 1111289..1111978 | - | 690 | WP_007609132.1 | RlmE family RNA methyltransferase | - |
BN2626_RS05250 | 1111980..1113047 | - | 1068 | WP_063996565.1 | Ppx/GppA family phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14569.80 Da Isoelectric Point: 6.7603
>T285784 WP_063992768.1 NZ_LN901633:1109141-1109533 [Bradyrhizobium sp.]
VIVVDASALLEVLLRTPAAATVEQRLFAPHQTLHAPHLLDVEVAQVIRRYAANREINVERGRMALADLADLSLRRYPHDF
LLPRIWELRNNLTAYDAAYVALAEALDTPLLTRDRRLAAAPGHHAQIELV
VIVVDASALLEVLLRTPAAATVEQRLFAPHQTLHAPHLLDVEVAQVIRRYAANREINVERGRMALADLADLSLRRYPHDF
LLPRIWELRNNLTAYDAAYVALAEALDTPLLTRDRRLAAAPGHHAQIELV
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|