Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
| Location | 5914921..5915462 | Replicon | chromosome |
| Accession | NZ_LN890477 | ||
| Organism | Achromobacter xylosoxidans isolate R8 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | BN2910_RS27535 | Protein ID | WP_026384571.1 |
| Coordinates | 5914921..5915196 (-) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | BN2910_RS27540 | Protein ID | WP_047991248.1 |
| Coordinates | 5915196..5915462 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN2910_RS27515 | 5910873..5911796 | + | 924 | WP_006385014.1 | ABC transporter permease | - |
| BN2910_RS27520 | 5911802..5912668 | + | 867 | WP_155873619.1 | ABC transporter permease | - |
| BN2910_RS27525 | 5912726..5914465 | + | 1740 | WP_155873621.1 | peptidase M14 | - |
| BN2910_RS27530 | 5914478..5914915 | + | 438 | WP_020928528.1 | acetyltransferase | - |
| BN2910_RS27535 | 5914921..5915196 | - | 276 | WP_026384571.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| BN2910_RS27540 | 5915196..5915462 | - | 267 | WP_047991248.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| BN2910_RS27545 | 5915709..5916236 | + | 528 | WP_054482172.1 | sigma-70 family RNA polymerase sigma factor | - |
| BN2910_RS27550 | 5916310..5917278 | + | 969 | WP_155874255.1 | FecR domain-containing protein | - |
| BN2910_RS27555 | 5917571..5919940 | + | 2370 | WP_173361383.1 | TonB-dependent receptor | - |
| BN2910_RS27560 | 5919998..5920204 | - | 207 | WP_026384567.1 | Hyp domain-containing protein 2 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10710.42 Da Isoelectric Point: 10.4170
>T285773 WP_026384571.1 NZ_LN890477:c5915196-5914921 [Achromobacter xylosoxidans]
MEMKWTSKALSDLARLHEFLAAVNRPAAVRAVQALVKASSVLPTNSRIGEQLFQFEPREVRRILVGEYEIRYEIRDSIIY
VLRLWHTRENR
MEMKWTSKALSDLARLHEFLAAVNRPAAVRAVQALVKASSVLPTNSRIGEQLFQFEPREVRRILVGEYEIRYEIRDSIIY
VLRLWHTRENR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|