Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 5650843..5651507 | Replicon | chromosome |
| Accession | NZ_LN890477 | ||
| Organism | Achromobacter xylosoxidans isolate R8 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | BN2910_RS26210 | Protein ID | WP_054506208.1 |
| Coordinates | 5650843..5651028 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | BN2910_RS26215 | Protein ID | WP_155873482.1 |
| Coordinates | 5651097..5651507 (+) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN2910_RS26175 | 5645909..5647249 | - | 1341 | WP_155873470.1 | phage portal protein | - |
| BN2910_RS26180 | 5647249..5648946 | - | 1698 | WP_155873472.1 | terminase large subunit | - |
| BN2910_RS26185 | 5648992..5649318 | - | 327 | WP_070668504.1 | hypothetical protein | - |
| BN2910_RS26190 | 5649476..5649811 | - | 336 | WP_155873474.1 | HNH endonuclease | - |
| BN2910_RS26195 | 5649814..5650047 | - | 234 | WP_155873476.1 | hypothetical protein | - |
| BN2910_RS26200 | 5650044..5650430 | - | 387 | WP_155873478.1 | Hsp20/alpha crystallin family protein | - |
| BN2910_RS26205 | 5650434..5650643 | - | 210 | WP_155873480.1 | hypothetical protein | - |
| BN2910_RS26210 | 5650843..5651028 | + | 186 | WP_054506208.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| BN2910_RS26215 | 5651097..5651507 | + | 411 | WP_155873482.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| BN2910_RS26220 | 5651509..5652279 | - | 771 | WP_155873484.1 | DNA adenine methylase | - |
| BN2910_RS26225 | 5652444..5652617 | + | 174 | WP_155873487.1 | hypothetical protein | - |
| BN2910_RS26230 | 5652732..5653325 | - | 594 | WP_155873489.1 | hypothetical protein | - |
| BN2910_RS26235 | 5653322..5653702 | - | 381 | WP_155873492.1 | hypothetical protein | - |
| BN2910_RS26240 | 5653713..5654111 | - | 399 | WP_155873494.1 | hypothetical protein | - |
| BN2910_RS26245 | 5654111..5655838 | - | 1728 | WP_155873496.1 | toprim domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 5626604..5666092 | 39488 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6929.08 Da Isoelectric Point: 10.9041
>T285772 WP_054506208.1 NZ_LN890477:5650843-5651028 [Achromobacter xylosoxidans]
MKYSEFRRWLLRQGVKLEAHKSGSSHFKATLGDRMTVFPDHGSKEIGTGLVNKIKKDLGLK
MKYSEFRRWLLRQGVKLEAHKSGSSHFKATLGDRMTVFPDHGSKEIGTGLVNKIKKDLGLK
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14635.76 Da Isoelectric Point: 4.8998
>AT285772 WP_155873482.1 NZ_LN890477:5651097-5651507 [Achromobacter xylosoxidans]
MLTYSYTLTPDTNGTYLIQYPDLPEGAAVSESPNAAAEAAEGLEAVLQMYIDARRPIPMPSGVGDGAVNVGAMRTAKVLL
ANEMVRQGVRKADLARRLGLHAPQIDRLLDLSHNSKMDAIEDACKELGKRLDVSLV
MLTYSYTLTPDTNGTYLIQYPDLPEGAAVSESPNAAAEAAEGLEAVLQMYIDARRPIPMPSGVGDGAVNVGAMRTAKVLL
ANEMVRQGVRKADLARRLGLHAPQIDRLLDLSHNSKMDAIEDACKELGKRLDVSLV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|