Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-StbC
Location 5373220..5373890 Replicon chromosome
Accession NZ_LN890477
Organism Achromobacter xylosoxidans isolate R8

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag BN2910_RS25010 Protein ID WP_155873315.1
Coordinates 5373220..5373639 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A6M2XXM0
Locus tag BN2910_RS25015 Protein ID WP_033480715.1
Coordinates 5373636..5373890 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BN2910_RS24970 5368929..5369105 + 177 WP_155873305.1 transcriptional regulator -
BN2910_RS24975 5369102..5369560 + 459 WP_155873307.1 helix-turn-helix domain-containing protein -
BN2910_RS24980 5369599..5369967 - 369 WP_033981746.1 conjugal transfer transcriptional regulator TraJ -
BN2910_RS24985 5369970..5370254 - 285 WP_155873309.1 hypothetical protein -
BN2910_RS24990 5370266..5370508 - 243 WP_033981742.1 type I toxin-antitoxin system ptaRNA1 family toxin -
BN2910_RS24995 5370577..5372037 - 1461 WP_155873311.1 P-type conjugative transfer protein TrbL -
BN2910_RS25000 5372034..5372267 - 234 WP_075041564.1 entry exclusion lipoprotein TrbK -
BN2910_RS25005 5372281..5373063 - 783 WP_155873313.1 P-type conjugative transfer protein TrbJ -
BN2910_RS25010 5373220..5373639 - 420 WP_155873315.1 type II toxin-antitoxin system VapC family toxin Toxin
BN2910_RS25015 5373636..5373890 - 255 WP_033480715.1 Arc family DNA-binding protein Antitoxin
BN2910_RS25020 5375006..5375758 - 753 WP_155873317.1 ABC transporter ATPase -
BN2910_RS25025 5375745..5376623 - 879 WP_155873319.1 helicase RepA family protein -
BN2910_RS25030 5376626..5376850 - 225 WP_009363662.1 AlpA family phage regulatory protein -
BN2910_RS25035 5376936..5377937 + 1002 WP_155873320.1 LuxR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 5356028..5379337 23309


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-123)

Antitoxin

Arc-like DNA binding domain

(9-46)


Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 14996.24 Da        Isoelectric Point: 5.7484

>T285771 WP_155873315.1 NZ_LN890477:c5373639-5373220 [Achromobacter xylosoxidans]
MIVLDTNVVSEAMKPEPNPAVRAWLNEQVAETLYLSSVTLAELLFGIGALPNGKRKKGLGEALDGLLELFGERVLMFDTE
AARHYAELAVKARTAGKGFPTPDGYIGAIAASKRFIVATRDTSPFEAAGLTVINPWNHQ

Download         Length: 420 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9522.89 Da        Isoelectric Point: 6.4771

>AT285771 WP_033480715.1 NZ_LN890477:c5373890-5373636 [Achromobacter xylosoxidans]
MAILTVRNVPDEVHRALRLRAAEHGRSTEAEVREILESAVKSEKRIRMGDALAELGRRVGLTNEDFAVLDQVRDKVPAEP
MRFE

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A6M2XXM0

References