Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 4172984..4173664 | Replicon | chromosome |
Accession | NZ_LN890477 | ||
Organism | Achromobacter xylosoxidans isolate R8 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | BN2910_RS19565 | Protein ID | WP_006386381.1 |
Coordinates | 4172984..4173169 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | BN2910_RS19570 | Protein ID | WP_006386380.1 |
Coordinates | 4173245..4173664 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN2910_RS19555 | 4169123..4170526 | + | 1404 | WP_054446896.1 | dihydrolipoyl dehydrogenase | - |
BN2910_RS19560 | 4170698..4172737 | - | 2040 | WP_054482409.1 | pyruvate, phosphate dikinase | - |
BN2910_RS19565 | 4172984..4173169 | + | 186 | WP_006386381.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
BN2910_RS19570 | 4173245..4173664 | + | 420 | WP_006386380.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
BN2910_RS19575 | 4173755..4175173 | - | 1419 | WP_006386379.1 | argininosuccinate lyase | - |
BN2910_RS19580 | 4175386..4176717 | + | 1332 | WP_026382696.1 | mechanosensitive ion channel | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 7058.16 Da Isoelectric Point: 10.6654
>T285770 WP_006386381.1 NZ_LN890477:4172984-4173169 [Achromobacter xylosoxidans]
MKYSEFKKWLERQGAVFVAHRSGSSHFRVTLNGATTIFPYHGSKEMGKHLEHEIKKQLGLK
MKYSEFKKWLERQGAVFVAHRSGSSHFRVTLNGATTIFPYHGSKEMGKHLEHEIKKQLGLK
Download Length: 186 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15506.81 Da Isoelectric Point: 4.9597
>AT285770 WP_006386380.1 NZ_LN890477:4173245-4173664 [Achromobacter xylosoxidans]
MLTYPFTLTLDSNRTWLVRFPDIPEALTVGDDEQEAAINAREALEAALEIYFDARRPIPLPSPVSAGQASVTLPALITSK
VFLSNEMIQQGVRKAELARRMGVHMPQVDRLLDVRHASRIEQVESALEQLGRRLEVSLA
MLTYPFTLTLDSNRTWLVRFPDIPEALTVGDDEQEAAINAREALEAALEIYFDARRPIPLPSPVSAGQASVTLPALITSK
VFLSNEMIQQGVRKAELARRMGVHMPQVDRLLDVRHASRIEQVESALEQLGRRLEVSLA
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|