Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 3432137..3432701 | Replicon | chromosome |
Accession | NZ_LN890477 | ||
Organism | Achromobacter xylosoxidans isolate R8 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0D6IHV7 |
Locus tag | BN2910_RS16085 | Protein ID | WP_020926667.1 |
Coordinates | 3432420..3432701 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0D6IHW1 |
Locus tag | BN2910_RS16080 | Protein ID | WP_020926666.1 |
Coordinates | 3432137..3432433 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN2910_RS16055 | 3427591..3427902 | - | 312 | WP_006386651.1 | helix-turn-helix domain-containing protein | - |
BN2910_RS16060 | 3427899..3428267 | - | 369 | WP_006386650.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
BN2910_RS16065 | 3428437..3429372 | - | 936 | WP_006386649.1 | protein translocase subunit SecF | - |
BN2910_RS16070 | 3429424..3431304 | - | 1881 | WP_006386648.1 | protein translocase subunit SecD | - |
BN2910_RS16075 | 3431420..3431764 | - | 345 | WP_006386647.1 | preprotein translocase subunit YajC | - |
BN2910_RS16080 | 3432137..3432433 | + | 297 | WP_020926666.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
BN2910_RS16085 | 3432420..3432701 | + | 282 | WP_020926667.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
BN2910_RS16090 | 3432751..3433887 | - | 1137 | WP_020926668.1 | tRNA guanosine(34) transglycosylase Tgt | - |
BN2910_RS16095 | 3433884..3434939 | - | 1056 | WP_026385110.1 | tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA | - |
BN2910_RS16100 | 3435175..3436008 | - | 834 | WP_155872454.1 | IclR family transcriptional regulator | - |
BN2910_RS16105 | 3436130..3437143 | + | 1014 | WP_155872455.1 | LLM class flavin-dependent oxidoreductase | - |
BN2910_RS16110 | 3437167..3437670 | + | 504 | WP_047993287.1 | flavin reductase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10262.77 Da Isoelectric Point: 7.0080
>T285769 WP_020926667.1 NZ_LN890477:3432420-3432701 [Achromobacter xylosoxidans]
VPAVEWSSAARADLLAIVDYISDDNPDAAQRLKDDIETKAAQLPARPALYRPGRIAGTREMVVRANYIIVYAADALAVRI
LRILHAAQQWPPQ
VPAVEWSSAARADLLAIVDYISDDNPDAAQRLKDDIETKAAQLPARPALYRPGRIAGTREMVVRANYIIVYAADALAVRI
LRILHAAQQWPPQ
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D6IHV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D6IHW1 |