Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 1011734..1012307 | Replicon | chromosome |
Accession | NZ_LN890477 | ||
Organism | Achromobacter xylosoxidans isolate R8 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | BN2910_RS04775 | Protein ID | WP_054507022.1 |
Coordinates | 1011734..1012111 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | BN2910_RS04780 | Protein ID | WP_054471260.1 |
Coordinates | 1012098..1012307 (-) | Length | 70 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN2910_RS04750 | 1008406..1009323 | + | 918 | WP_054439442.1 | septum site-determining protein MinC | - |
BN2910_RS04755 | 1009512..1010327 | + | 816 | WP_006388978.1 | septum site-determining protein MinD | - |
BN2910_RS04760 | 1010331..1010588 | + | 258 | WP_006388977.1 | cell division topological specificity factor MinE | - |
BN2910_RS04765 | 1010718..1010942 | - | 225 | WP_006388976.1 | glycine zipper 2TM domain-containing protein | - |
BN2910_RS04770 | 1011133..1011666 | - | 534 | WP_054504957.1 | isochorismatase family protein | - |
BN2910_RS04775 | 1011734..1012111 | - | 378 | WP_054507022.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
BN2910_RS04780 | 1012098..1012307 | - | 210 | WP_054471260.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
BN2910_RS04785 | 1012432..1014105 | - | 1674 | WP_024067854.1 | energy-dependent translational throttle protein EttA | - |
BN2910_RS04790 | 1014257..1015075 | + | 819 | WP_054472847.1 | AAC(3) family N-acetyltransferase | - |
BN2910_RS04795 | 1015088..1016014 | - | 927 | WP_020924995.1 | DMT family transporter | - |
BN2910_RS04800 | 1016113..1016901 | + | 789 | WP_024067852.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13890.15 Da Isoelectric Point: 6.3739
>T285767 WP_054507022.1 NZ_LN890477:c1012111-1011734 [Achromobacter xylosoxidans]
MILVDTSIWIDHLSDGEPFLVRLLEEESVLMHPFIAGELALGSLGRRDVVLGAMSLLPQVVRASHDEVMHFLHSERLFGK
GIGYVDLHLLASTRLTPGAALWTRDKRLQALATTLSLAVDPPRYH
MILVDTSIWIDHLSDGEPFLVRLLEEESVLMHPFIAGELALGSLGRRDVVLGAMSLLPQVVRASHDEVMHFLHSERLFGK
GIGYVDLHLLASTRLTPGAALWTRDKRLQALATTLSLAVDPPRYH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|