Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-parD/RelE(toxin) |
| Location | 5927521..5928107 | Replicon | chromosome |
| Accession | NZ_LN890476 | ||
| Organism | Achromobacter xylosoxidans isolate R4 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | BN2905_RS27390 | Protein ID | WP_148318248.1 |
| Coordinates | 5927805..5928107 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | BN2905_RS27385 | Protein ID | WP_155869076.1 |
| Coordinates | 5927521..5927808 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN2905_RS27365 | 5923215..5924138 | + | 924 | WP_155869071.1 | ABC transporter permease | - |
| BN2905_RS27370 | 5924144..5925010 | + | 867 | WP_006385013.1 | ABC transporter permease | - |
| BN2905_RS27375 | 5925068..5926807 | + | 1740 | WP_155869073.1 | peptidase M14 | - |
| BN2905_RS27380 | 5926820..5927257 | + | 438 | WP_006385010.1 | acetyltransferase | - |
| BN2905_RS27385 | 5927521..5927808 | + | 288 | WP_155869076.1 | hypothetical protein | Antitoxin |
| BN2905_RS27390 | 5927805..5928107 | + | 303 | WP_148318248.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| BN2905_RS27395 | 5928159..5928365 | - | 207 | WP_155869079.1 | hypothetical protein | - |
| BN2905_RS27400 | 5928362..5928937 | - | 576 | WP_155869082.1 | GNAT family N-acetyltransferase | - |
| BN2905_RS27405 | 5929029..5929664 | - | 636 | WP_047991253.1 | methyltransferase domain-containing protein | - |
| BN2905_RS27410 | 5929661..5931211 | - | 1551 | WP_155869085.1 | lytic murein transglycosylase | - |
| BN2905_RS27415 | 5931314..5931976 | - | 663 | WP_155869087.1 | hypothetical protein | - |
| BN2905_RS27420 | 5932140..5933060 | + | 921 | WP_020928537.1 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11266.82 Da Isoelectric Point: 5.6016
>T285766 WP_148318248.1 NZ_LN890476:5927805-5928107 [Achromobacter xylosoxidans]
VRALRWTPEAIQDREAIYDFIEADSPVAALMLDELLEQQAGRLIDHPGLGRPGRVAGTRELVAHPNYLLIYDVTNDLVRM
LRVLHAARQWPTPDSSPGNR
VRALRWTPEAIQDREAIYDFIEADSPVAALMLDELLEQQAGRLIDHPGLGRPGRVAGTRELVAHPNYLLIYDVTNDLVRM
LRVLHAARQWPTPDSSPGNR
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|