Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 4223845..4224467 | Replicon | chromosome |
Accession | NZ_LN890476 | ||
Organism | Achromobacter xylosoxidans isolate R4 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | BN2905_RS19790 | Protein ID | WP_054505594.1 |
Coordinates | 4224153..4224467 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | BN2905_RS19785 | Protein ID | WP_054508121.1 |
Coordinates | 4223845..4224156 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN2905_RS19750 | 4219119..4220012 | + | 894 | WP_104414222.1 | diiron oxygenase | - |
BN2905_RS19755 | 4220027..4220983 | + | 957 | WP_155868353.1 | nitronate monooxygenase | - |
BN2905_RS19760 | 4221041..4221826 | + | 786 | WP_006386406.1 | hypothetical protein | - |
BN2905_RS19765 | 4221827..4222210 | + | 384 | WP_006386405.1 | hypothetical protein | - |
BN2905_RS19770 | 4222185..4222703 | + | 519 | WP_006386404.1 | 4'-phosphopantetheinyl transferase superfamily protein | - |
BN2905_RS19780 | 4222966..4223748 | - | 783 | WP_155868354.1 | exodeoxyribonuclease III | - |
BN2905_RS19785 | 4223845..4224156 | - | 312 | WP_054508121.1 | putative addiction module antidote protein | Antitoxin |
BN2905_RS19790 | 4224153..4224467 | - | 315 | WP_054505594.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
BN2905_RS19795 | 4224890..4228231 | + | 3342 | WP_155868355.1 | viral (Super1) RNA helicase | - |
BN2905_RS19800 | 4228260..4229036 | - | 777 | WP_024068578.1 | 3-oxoacyl-ACP reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11792.46 Da Isoelectric Point: 8.5141
>T285765 WP_054505594.1 NZ_LN890476:c4224467-4224153 [Achromobacter xylosoxidans]
MYHIKPLPEFDAWFDTLTDPATRARLIRRLEKAARGLLGDVKPVGEGVSEMREFFGPGWRMYYAERGNVLIVMLGGGTKG
TQSRDVKHAKELARALRNDEEDQS
MYHIKPLPEFDAWFDTLTDPATRARLIRRLEKAARGLLGDVKPVGEGVSEMREFFGPGWRMYYAERGNVLIVMLGGGTKG
TQSRDVKHAKELARALRNDEEDQS
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|