Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 989485..990058 | Replicon | chromosome |
| Accession | NZ_LN890476 | ||
| Organism | Achromobacter xylosoxidans isolate R4 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | BN2905_RS04630 | Protein ID | WP_049054629.1 |
| Coordinates | 989485..989862 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | BN2905_RS04635 | Protein ID | WP_054471260.1 |
| Coordinates | 989849..990058 (-) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN2905_RS04605 | 986157..987074 | + | 918 | WP_054443171.1 | septum site-determining protein MinC | - |
| BN2905_RS04610 | 987263..988078 | + | 816 | WP_006388978.1 | septum site-determining protein MinD | - |
| BN2905_RS04615 | 988082..988339 | + | 258 | WP_006388977.1 | cell division topological specificity factor MinE | - |
| BN2905_RS04620 | 988469..988693 | - | 225 | WP_006388976.1 | glycine zipper 2TM domain-containing protein | - |
| BN2905_RS04625 | 988884..989417 | - | 534 | WP_024067855.1 | isochorismatase family protein | - |
| BN2905_RS04630 | 989485..989862 | - | 378 | WP_049054629.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| BN2905_RS04635 | 989849..990058 | - | 210 | WP_054471260.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| BN2905_RS04640 | 990183..991856 | - | 1674 | WP_024067854.1 | energy-dependent translational throttle protein EttA | - |
| BN2905_RS04645 | 992008..992826 | + | 819 | WP_155866994.1 | AAC(3) family N-acetyltransferase | - |
| BN2905_RS04650 | 992839..993765 | - | 927 | WP_020924995.1 | DMT family transporter | - |
| BN2905_RS04655 | 993864..994652 | + | 789 | WP_049054627.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13846.11 Da Isoelectric Point: 6.3721
>T285764 WP_049054629.1 NZ_LN890476:c989862-989485 [Achromobacter xylosoxidans]
MILVDTSIWIDHLSDGEPCLVRLLEEESVLMHPFIAGELALGSLGRRDVVLGAMSLLPQVVRASHDEVMHFLHSERLFGK
GIGYVDLHLLASTRLTPGAALWTRDKRLQALATTLSLAVDPPRYH
MILVDTSIWIDHLSDGEPCLVRLLEEESVLMHPFIAGELALGSLGRRDVVLGAMSLLPQVVRASHDEVMHFLHSERLFGK
GIGYVDLHLLASTRLTPGAALWTRDKRLQALATTLSLAVDPPRYH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|