Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-parD/RelE(toxin) |
| Location | 5725881..5726467 | Replicon | chromosome |
| Accession | NZ_LN890335 | ||
| Organism | Achromobacter xylosoxidans isolate AX_NCIMB_11015_WG | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | BN2877_RS26075 | Protein ID | WP_155866249.1 |
| Coordinates | 5726165..5726467 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | BN2877_RS26070 | Protein ID | WP_054436906.1 |
| Coordinates | 5725881..5726168 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN2877_RS26050 | 5721580..5722503 | + | 924 | WP_006385014.1 | ABC transporter permease | - |
| BN2877_RS26055 | 5722509..5723375 | + | 867 | WP_006385013.1 | ABC transporter permease | - |
| BN2877_RS26060 | 5723433..5725172 | + | 1740 | WP_155866248.1 | peptidase M14 | - |
| BN2877_RS26065 | 5725185..5725622 | + | 438 | WP_006385010.1 | acetyltransferase | - |
| BN2877_RS26070 | 5725881..5726168 | + | 288 | WP_054436906.1 | hypothetical protein | Antitoxin |
| BN2877_RS26075 | 5726165..5726467 | + | 303 | WP_155866249.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| BN2877_RS26080 | 5726510..5726779 | - | 270 | WP_155866250.1 | ribbon-helix-helix domain-containing protein | - |
| BN2877_RS26085 | 5727023..5727550 | + | 528 | WP_155866251.1 | sigma-70 family RNA polymerase sigma factor | - |
| BN2877_RS26090 | 5727636..5728592 | + | 957 | WP_155866640.1 | FecR domain-containing protein | - |
| BN2877_RS26095 | 5728852..5731278 | + | 2427 | WP_161800435.1 | TonB-dependent receptor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11423.99 Da Isoelectric Point: 5.6391
>T285763 WP_155866249.1 NZ_LN890335:5726165-5726467 [Achromobacter xylosoxidans]
VRALRWTPEAIRDREAIYDFIEADSPVAALMLDELLEEQAGRPIDHPGLGRPGRVTGTRELVAHPNYLLIYDVTNDLVRM
LRVLHAARQWPTPDPSSERR
VRALRWTPEAIRDREAIYDFIEADSPVAALMLDELLEEQAGRPIDHPGLGRPGRVTGTRELVAHPNYLLIYDVTNDLVRM
LRVLHAARQWPTPDPSSERR
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|