Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 4060329..4061009 | Replicon | chromosome |
Accession | NZ_LN890335 | ||
Organism | Achromobacter xylosoxidans isolate AX_NCIMB_11015_WG |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | BN2877_RS18670 | Protein ID | WP_006386381.1 |
Coordinates | 4060329..4060514 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | BN2877_RS18675 | Protein ID | WP_006386380.1 |
Coordinates | 4060590..4061009 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN2877_RS18660 | 4056465..4057868 | + | 1404 | WP_107316537.1 | dihydrolipoyl dehydrogenase | - |
BN2877_RS18665 | 4058043..4060081 | - | 2039 | Protein_3673 | pyruvate, phosphate dikinase | - |
BN2877_RS18670 | 4060329..4060514 | + | 186 | WP_006386381.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
BN2877_RS18675 | 4060590..4061009 | + | 420 | WP_006386380.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
BN2877_RS18680 | 4061100..4062518 | - | 1419 | WP_006386379.1 | argininosuccinate lyase | - |
BN2877_RS18685 | 4062731..4064062 | + | 1332 | WP_024068593.1 | mechanosensitive ion channel | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 7058.16 Da Isoelectric Point: 10.6654
>T285762 WP_006386381.1 NZ_LN890335:4060329-4060514 [Achromobacter xylosoxidans]
MKYSEFKKWLERQGAVFVAHRSGSSHFRVTLNGATTIFPYHGSKEMGKHLEHEIKKQLGLK
MKYSEFKKWLERQGAVFVAHRSGSSHFRVTLNGATTIFPYHGSKEMGKHLEHEIKKQLGLK
Download Length: 186 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15506.81 Da Isoelectric Point: 4.9597
>AT285762 WP_006386380.1 NZ_LN890335:4060590-4061009 [Achromobacter xylosoxidans]
MLTYPFTLTLDSNRTWLVRFPDIPEALTVGDDEQEAAINAREALEAALEIYFDARRPIPLPSPVSAGQASVTLPALITSK
VFLSNEMIQQGVRKAELARRMGVHMPQVDRLLDVRHASRIEQVESALEQLGRRLEVSLA
MLTYPFTLTLDSNRTWLVRFPDIPEALTVGDDEQEAAINAREALEAALEIYFDARRPIPLPSPVSAGQASVTLPALITSK
VFLSNEMIQQGVRKAELARRMGVHMPQVDRLLDVRHASRIEQVESALEQLGRRLEVSLA
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|