Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 3204246..3204810 | Replicon | chromosome |
| Accession | NZ_LN890335 | ||
| Organism | Achromobacter xylosoxidans isolate AX_NCIMB_11015_WG | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A0D6IHV7 |
| Locus tag | BN2877_RS14695 | Protein ID | WP_020926667.1 |
| Coordinates | 3204529..3204810 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0D6IHW1 |
| Locus tag | BN2877_RS14690 | Protein ID | WP_020926666.1 |
| Coordinates | 3204246..3204542 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN2877_RS14665 | 3199703..3200014 | - | 312 | WP_006386651.1 | helix-turn-helix domain-containing protein | - |
| BN2877_RS14670 | 3200011..3200379 | - | 369 | WP_155865521.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| BN2877_RS14675 | 3200549..3201484 | - | 936 | WP_006386649.1 | protein translocase subunit SecF | - |
| BN2877_RS14680 | 3201536..3203416 | - | 1881 | WP_006386648.1 | protein translocase subunit SecD | - |
| BN2877_RS14685 | 3203532..3203875 | - | 344 | Protein_2894 | preprotein translocase subunit YajC | - |
| BN2877_RS14690 | 3204246..3204542 | + | 297 | WP_020926666.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| BN2877_RS14695 | 3204529..3204810 | + | 282 | WP_020926667.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| BN2877_RS14700 | 3204860..3205996 | - | 1137 | WP_049051050.1 | tRNA guanosine(34) transglycosylase Tgt | - |
| BN2877_RS14705 | 3205993..3207048 | - | 1056 | WP_155865522.1 | tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA | - |
| BN2877_RS14710 | 3207284..3208117 | - | 834 | WP_053514737.1 | IclR family transcriptional regulator | - |
| BN2877_RS14715 | 3208239..3209252 | + | 1014 | WP_155865523.1 | LLM class flavin-dependent oxidoreductase | - |
| BN2877_RS14720 | 3209276..3209779 | + | 504 | WP_047993287.1 | flavin reductase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10262.77 Da Isoelectric Point: 7.0080
>T285761 WP_020926667.1 NZ_LN890335:3204529-3204810 [Achromobacter xylosoxidans]
VPAVEWSSAARADLLAIVDYISDDNPDAAQRLKDDIETKAAQLPARPALYRPGRIAGTREMVVRANYIIVYAADALAVRI
LRILHAAQQWPPQ
VPAVEWSSAARADLLAIVDYISDDNPDAAQRLKDDIETKAAQLPARPALYRPGRIAGTREMVVRANYIIVYAADALAVRI
LRILHAAQQWPPQ
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D6IHV7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D6IHW1 |