Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 1830280..1830833 | Replicon | chromosome |
Accession | NZ_LN890335 | ||
Organism | Achromobacter xylosoxidans isolate AX_NCIMB_11015_WG |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | BN2877_RS08320 | Protein ID | WP_054515607.1 |
Coordinates | 1830280..1830558 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | BN2877_RS08325 | Protein ID | WP_155865067.1 |
Coordinates | 1830627..1830833 (-) | Length | 69 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN2877_RS08295 | 1826212..1826898 | + | 687 | WP_006386994.1 | hypothetical protein | - |
BN2877_RS08300 | 1826983..1827459 | - | 477 | WP_006386993.1 | bacterioferritin | - |
BN2877_RS08305 | 1827884..1828798 | - | 915 | WP_155865065.1 | DMT family transporter | - |
BN2877_RS08310 | 1828912..1829832 | + | 921 | WP_006386991.1 | LysR family transcriptional regulator | - |
BN2877_RS08315 | 1829802..1830101 | - | 300 | WP_006386990.1 | (2Fe-2S)-binding protein | - |
BN2877_RS08320 | 1830280..1830558 | - | 279 | WP_054515607.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
BN2877_RS08325 | 1830627..1830833 | - | 207 | WP_155865067.1 | stability determinant | Antitoxin |
BN2877_RS08330 | 1830927..1832372 | - | 1446 | WP_024067399.1 | RNA polymerase factor sigma-54 | - |
BN2877_RS08335 | 1832371..1833021 | + | 651 | WP_024067398.1 | hypothetical protein | - |
BN2877_RS08340 | 1833213..1834190 | + | 978 | WP_054446050.1 | tripartite tricarboxylate transporter substrate binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10342.86 Da Isoelectric Point: 9.0854
>T285759 WP_054515607.1 NZ_LN890335:c1830558-1830280 [Achromobacter xylosoxidans]
MLDVSWLQTAADDLAGIISYIAERSPQAARDLRQRIDNAVLSLARHPCRYRAGRVSGTRECVVHPNYVVAYRVTALAIEV
VNIVHARREYPP
MLDVSWLQTAADDLAGIISYIAERSPQAARDLRQRIDNAVLSLARHPCRYRAGRVSGTRECVVHPNYVVAYRVTALAIEV
VNIVHARREYPP
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|