Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
| Location | 1105772..1106312 | Replicon | chromosome |
| Accession | NZ_LN890331 | ||
| Organism | Leuconostoc gelidum subsp. gasicomitatum KG16-1 isolate LEKG1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | LEKG_RS05330 | Protein ID | WP_060391596.1 |
| Coordinates | 1106031..1106312 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | LEKG_RS05325 | Protein ID | WP_060391595.1 |
| Coordinates | 1105772..1106044 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LEKG_RS05295 | 1101108..1101590 | - | 483 | WP_060391589.1 | hypothetical protein | - |
| LEKG_RS05300 | 1101606..1103861 | - | 2256 | WP_060391590.1 | toprim domain-containing protein | - |
| LEKG_RS05305 | 1103848..1104114 | - | 267 | WP_060391591.1 | hypothetical protein | - |
| LEKG_RS05310 | 1104571..1105002 | + | 432 | WP_060391592.1 | JAB domain-containing protein | - |
| LEKG_RS05315 | 1105116..1105493 | + | 378 | WP_060391593.1 | hypothetical protein | - |
| LEKG_RS05320 | 1105475..1105690 | + | 216 | WP_060391594.1 | hypothetical protein | - |
| LEKG_RS05325 | 1105772..1106044 | + | 273 | WP_060391595.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| LEKG_RS05330 | 1106031..1106312 | + | 282 | WP_060391596.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| LEKG_RS05335 | 1106721..1106948 | + | 228 | WP_060391597.1 | hypothetical protein | - |
| LEKG_RS05340 | 1106945..1107387 | + | 443 | Protein_1063 | hypothetical protein | - |
| LEKG_RS05345 | 1107481..1107699 | + | 219 | WP_060391598.1 | hypothetical protein | - |
| LEKG_RS05350 | 1108052..1108294 | + | 243 | WP_060391599.1 | hypothetical protein | - |
| LEKG_RS05355 | 1108269..1108634 | + | 366 | WP_060391600.1 | hypothetical protein | - |
| LEKG_RS05360 | 1108621..1108914 | + | 294 | WP_060391601.1 | hypothetical protein | - |
| LEKG_RS05365 | 1108932..1109225 | + | 294 | WP_060391602.1 | hypothetical protein | - |
| LEKG_RS05370 | 1109244..1109492 | + | 249 | WP_060391603.1 | hypothetical protein | - |
| LEKG_RS05375 | 1109494..1109730 | - | 237 | Protein_1070 | hypothetical protein | - |
| LEKG_RS05380 | 1109847..1110596 | - | 750 | WP_060391605.1 | glucose 1-dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10744.53 Da Isoelectric Point: 9.4689
>T285757 WP_060391596.1 NZ_LN890331:1106031-1106312 [Leuconostoc gelidum subsp. gasicomitatum KG16-1]
MYKVRQSNQFKKSVKRVVKQGKDLDKLFHIVDLILSGDPLPAHYKDHVLNGKKWHGIRELHIEPDWLLAYQIDNGELVLL
LVDTGSHSQMLGM
MYKVRQSNQFKKSVKRVVKQGKDLDKLFHIVDLILSGDPLPAHYKDHVLNGKKWHGIRELHIEPDWLLAYQIDNGELVLL
LVDTGSHSQMLGM
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|