Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-DinJ
Location 1105772..1106312 Replicon chromosome
Accession NZ_LN890331
Organism Leuconostoc gelidum subsp. gasicomitatum KG16-1 isolate LEKG1

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag LEKG_RS05330 Protein ID WP_060391596.1
Coordinates 1106031..1106312 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag LEKG_RS05325 Protein ID WP_060391595.1
Coordinates 1105772..1106044 (+) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LEKG_RS05295 1101108..1101590 - 483 WP_060391589.1 hypothetical protein -
LEKG_RS05300 1101606..1103861 - 2256 WP_060391590.1 toprim domain-containing protein -
LEKG_RS05305 1103848..1104114 - 267 WP_060391591.1 hypothetical protein -
LEKG_RS05310 1104571..1105002 + 432 WP_060391592.1 JAB domain-containing protein -
LEKG_RS05315 1105116..1105493 + 378 WP_060391593.1 hypothetical protein -
LEKG_RS05320 1105475..1105690 + 216 WP_060391594.1 hypothetical protein -
LEKG_RS05325 1105772..1106044 + 273 WP_060391595.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
LEKG_RS05330 1106031..1106312 + 282 WP_060391596.1 type II toxin-antitoxin system YafQ family toxin Toxin
LEKG_RS05335 1106721..1106948 + 228 WP_060391597.1 hypothetical protein -
LEKG_RS05340 1106945..1107387 + 443 Protein_1063 hypothetical protein -
LEKG_RS05345 1107481..1107699 + 219 WP_060391598.1 hypothetical protein -
LEKG_RS05350 1108052..1108294 + 243 WP_060391599.1 hypothetical protein -
LEKG_RS05355 1108269..1108634 + 366 WP_060391600.1 hypothetical protein -
LEKG_RS05360 1108621..1108914 + 294 WP_060391601.1 hypothetical protein -
LEKG_RS05365 1108932..1109225 + 294 WP_060391602.1 hypothetical protein -
LEKG_RS05370 1109244..1109492 + 249 WP_060391603.1 hypothetical protein -
LEKG_RS05375 1109494..1109730 - 237 Protein_1070 hypothetical protein -
LEKG_RS05380 1109847..1110596 - 750 WP_060391605.1 glucose 1-dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(1-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(6-70)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10744.53 Da        Isoelectric Point: 9.4689

>T285757 WP_060391596.1 NZ_LN890331:1106031-1106312 [Leuconostoc gelidum subsp. gasicomitatum KG16-1]
MYKVRQSNQFKKSVKRVVKQGKDLDKLFHIVDLILSGDPLPAHYKDHVLNGKKWHGIRELHIEPDWLLAYQIDNGELVLL
LVDTGSHSQMLGM

Download         Length: 282 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10281.65 Da        Isoelectric Point: 4.6461

>AT285757 WP_060391595.1 NZ_LN890331:1105772-1106044 [Leuconostoc gelidum subsp. gasicomitatum KG16-1]
MTTQKKANLNVKIDPQLKTEAETIFEDMGLTTTAAVNMFIKRVIDDRELPFKPRVTSTLDKALDDIENNRVETYDTAADW
KASLKEYVQS

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References