Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 2343443..2344044 | Replicon | chromosome |
| Accession | NZ_LN879547 | ||
| Organism | Comamonas thiooxydans isolate C19 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | BN2297_RS10550 | Protein ID | WP_019042333.1 |
| Coordinates | 2343443..2343829 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A076PMR1 |
| Locus tag | BN2297_RS10555 | Protein ID | WP_034356765.1 |
| Coordinates | 2343829..2344044 (-) | Length | 72 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN2297_RS10535 | 2340910..2342220 | - | 1311 | WP_034356769.1 | DNA polymerase Y family protein | - |
| BN2297_RS10540 | 2342165..2342965 | - | 801 | WP_122974731.1 | translesion DNA synthesis-associated protein ImuA | - |
| BN2297_RS10545 | 2343145..2343354 | - | 210 | WP_034356767.1 | hypothetical protein | - |
| BN2297_RS10550 | 2343443..2343829 | - | 387 | WP_019042333.1 | twitching motility protein PilT | Toxin |
| BN2297_RS10555 | 2343829..2344044 | - | 216 | WP_034356765.1 | DUF2191 domain-containing protein | Antitoxin |
| BN2297_RS10560 | 2344129..2344946 | + | 818 | Protein_2091 | SprT-like domain-containing protein | - |
| BN2297_RS10565 | 2345100..2345426 | + | 327 | WP_019042331.1 | transposase | - |
| BN2297_RS26040 | 2345769..2346674 | - | 906 | Protein_2093 | phosphoethanolamine transferase | - |
| BN2297_RS26045 | 2347688..2348077 | + | 390 | WP_080571250.1 | CzcE family metal-binding protein | - |
| BN2297_RS26050 | 2348157..2348603 | - | 447 | WP_019042328.1 | Cd(II)/Pb(II)-responsive transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2208970..2715678 | 506708 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 13999.29 Da Isoelectric Point: 5.0594
>T285751 WP_019042333.1 NZ_LN879547:c2343829-2343443 [Comamonas thiooxydans]
MPVSVLVDTSVWVRHFREADTHLQELLMQDSVLMHSMVHAELACGTPPAPRADTLAALAMLRPSQEASIPETLEFLEQNK
LFGKGCGLVDLSLLASTLITPGALLWTADRRLADMATQLNVAYLPPLH
MPVSVLVDTSVWVRHFREADTHLQELLMQDSVLMHSMVHAELACGTPPAPRADTLAALAMLRPSQEASIPETLEFLEQNK
LFGKGCGLVDLSLLASTLITPGALLWTADRRLADMATQLNVAYLPPLH
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|