Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 412692..413284 Replicon chromosome
Accession NZ_LN879429
Organism Bartonella henselae strain MVT02

Toxin (Protein)


Gene name hicA Uniprot ID A0A829Z6B5
Locus tag BM1374164_RS01695 Protein ID WP_034447446.1
Coordinates 413084..413284 (-) Length 67 a.a.

Antitoxin (Protein)


Gene name hicA Uniprot ID A0A840E534
Locus tag BM1374164_RS01690 Protein ID WP_011180290.1
Coordinates 412692..413087 (-) Length 132 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BM1374164_RS01660 407957..408715 - 759 WP_011180282.1 phage antirepressor Ant -
BM1374164_RS01665 408775..409290 - 516 WP_011180283.1 phage antirepressor Ant -
BM1374164_RS01670 409583..410146 - 564 Protein_328 antA/AntB antirepressor family protein -
BM1374164_RS01675 410178..410720 - 543 WP_011180285.1 phage antirepressor Ant -
BM1374164_RS01680 411317..411895 - 579 WP_011180287.1 hypothetical protein -
BM1374164_RS01685 411899..412219 - 321 WP_011180288.1 hypothetical protein -
BM1374164_RS01690 412692..413087 - 396 WP_011180290.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
BM1374164_RS01695 413084..413284 - 201 WP_034447446.1 type II toxin-antitoxin system HicA family toxin Toxin
BM1374164_RS01700 413349..413885 - 537 WP_034447444.1 hypothetical protein -
BM1374164_RS01705 413896..414342 - 447 WP_011180293.1 single-stranded DNA-binding protein -
BM1374164_RS01710 414533..414814 + 282 WP_011180826.1 type II toxin-antitoxin system RelE/ParE family toxin -
BM1374164_RS01715 414831..415124 + 294 WP_034447441.1 HigA family addiction module antidote protein -
BM1374164_RS01720 415166..415492 - 327 WP_034447437.1 hypothetical protein -
BM1374164_RS01725 415657..416076 - 420 WP_038525124.1 hypothetical protein -
BM1374164_RS01730 416069..417181 - 1113 WP_011180297.1 DUF1376 domain-containing protein -
BM1374164_RS01735 417171..417518 - 348 WP_011180298.1 DUF1376 domain-containing protein -
BM1374164_RS01740 417511..417987 - 477 WP_011180299.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 362344..432004 69660


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(5-125)


Sequences

Toxin        


Download         Length: 67 a.a.        Molecular weight: 7492.81 Da        Isoelectric Point: 10.9914

>T285744 WP_034447446.1 NZ_LN879429:c413284-413084 [Bartonella henselae]
MEQNSRKIIAKLKRDGFELVKVKGSHHKFKKDGKVVIVPHPKKNLPIGTARSIAQQAGWFKKGEEE

Download         Length: 201 bp

Antitoxin


Download         Length: 132 a.a.        Molecular weight: 14718.71 Da        Isoelectric Point: 4.3191

>AT285744 WP_011180290.1 NZ_LN879429:c413087-412692 [Bartonella henselae]
MKRFFALVHKDEDSAFGVQFPDFEGLFSAADEEENLIINATEALQLYCEDMDTVPVPLKFEEVIQQKAVKKALSEGAFLI
QVPFIENDSEVVRTNISIERGLLRAIDNCAQERGLTRSAFLATAARHELNI

Download         Length: 396 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829Z6B5

Antitoxin

Source ID Structure
AlphaFold DB A0A840E534

References