Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-RelB
Location 407108..407639 Replicon chromosome
Accession NZ_LN879429
Organism Bartonella henselae strain MVT02

Toxin (Protein)


Gene name relE Uniprot ID X5M5T9
Locus tag BM1374164_RS01650 Protein ID WP_011180281.1
Coordinates 407358..407639 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID A0A0H3LWD6
Locus tag BM1374164_RS01645 Protein ID WP_011180280.1
Coordinates 407108..407371 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BM1374164_RS01620 403254..403502 - 249 WP_011180274.1 hypothetical protein -
BM1374164_RS01625 403506..405434 - 1929 WP_011180275.1 phage terminase large subunit family protein -
BM1374164_RS01630 405427..406008 - 582 WP_011180276.1 hypothetical protein -
BM1374164_RS01635 406071..406385 + 315 WP_011180277.1 type II toxin-antitoxin system RelE/ParE family toxin -
BM1374164_RS01640 406402..406698 + 297 WP_011180278.1 HigA family addiction module antidote protein -
BM1374164_RS01645 407108..407371 + 264 WP_011180280.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
BM1374164_RS01650 407358..407639 + 282 WP_011180281.1 type II toxin-antitoxin system YafQ family toxin Toxin
BM1374164_RS01655 407682..407960 - 279 WP_011180242.1 hypothetical protein -
BM1374164_RS01660 407957..408715 - 759 WP_011180282.1 phage antirepressor Ant -
BM1374164_RS01665 408775..409290 - 516 WP_011180283.1 phage antirepressor Ant -
BM1374164_RS01670 409583..410146 - 564 Protein_328 antA/AntB antirepressor family protein -
BM1374164_RS01675 410178..410720 - 543 WP_011180285.1 phage antirepressor Ant -
BM1374164_RS01680 411317..411895 - 579 WP_011180287.1 hypothetical protein -
BM1374164_RS01685 411899..412219 - 321 WP_011180288.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 362344..432004 69660


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(2-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-82)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11106.85 Da        Isoelectric Point: 10.3380

>T285743 WP_011180281.1 NZ_LN879429:407358-407639 [Bartonella henselae]
MRTIERTTIFKRDFKREMKGQHRHLLDTDLRKVIAALANDQPLEIRYRDHALTGNWSNYRDCHIRPDLVLIYRLIGQDRL
VLVRLGSHSQLDL

Download         Length: 282 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9565.81 Da        Isoelectric Point: 4.1403

>AT285743 WP_011180280.1 NZ_LN879429:407108-407371 [Bartonella henselae]
MATSRMVQARVPEEIQNVASQVIQASGLTVSDVVRVLMTRIAQDKAIPSVLFQPNAETIAAFAEVDEGNLKKFHSVDELF
DDLYADD

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0R4J6H3

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3LWD6

References