Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 4718250..4718858 | Replicon | chromosome |
Accession | NZ_LN871187 | ||
Organism | Pseudomonas aeruginosa strain PAO1_Orsay |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | Q9I5J9 |
Locus tag | PAO1OR_RS21760 | Protein ID | WP_003114156.1 |
Coordinates | 4718250..4718597 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | PAO1OR_RS29600 | Protein ID | WP_003114155.1 |
Coordinates | 4718607..4718858 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAO1OR_RS21730 | 4713609..4713881 | + | 273 | WP_010895521.1 | cysteine-rich CWC family protein | - |
PAO1OR_RS21735 | 4713881..4714573 | + | 693 | WP_003114159.1 | 16S rRNA pseudouridine(516) synthase | - |
PAO1OR_RS21740 | 4714709..4715752 | + | 1044 | WP_003098363.1 | L,D-transpeptidase | - |
PAO1OR_RS21745 | 4715832..4716569 | + | 738 | WP_003114158.1 | murein L,D-transpeptidase catalytic domain family protein | - |
PAO1OR_RS21750 | 4717021..4717923 | + | 903 | WP_003114157.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
PAO1OR_RS21760 | 4718250..4718597 | - | 348 | WP_003114156.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PAO1OR_RS29600 | 4718607..4718858 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PAO1OR_RS21765 | 4719072..4720055 | - | 984 | WP_003114154.1 | tyrosine-type recombinase/integrase | - |
PAO1OR_RS21770 | 4720055..4721347 | - | 1293 | WP_003115206.1 | hypothetical protein | - |
PAO1OR_RS21775 | 4721577..4722851 | - | 1275 | WP_010895520.1 | zonular occludens toxin family protein | - |
PAO1OR_RS21780 | 4722855..4723211 | - | 357 | WP_003114150.1 | DUF2523 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | catB7 | - | 4718250..4740420 | 22170 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12984.78 Da Isoelectric Point: 4.4212
>T285740 WP_003114156.1 NZ_LN871187:c4718597-4718250 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9I5J9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |