Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 143573..144078 | Replicon | chromosome |
Accession | NZ_LN871187 | ||
Organism | Pseudomonas aeruginosa strain PAO1_Orsay |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | PAO1OR_RS00635 | Protein ID | WP_003083773.1 |
Coordinates | 143573..143854 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q9I707 |
Locus tag | PAO1OR_RS00640 | Protein ID | WP_003112628.1 |
Coordinates | 143851..144078 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAO1OR_RS00610 | 138824..140173 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
PAO1OR_RS00615 | 140222..140908 | + | 687 | WP_003083762.1 | FadR family transcriptional regulator | - |
PAO1OR_RS00620 | 141009..141743 | + | 735 | WP_003115036.1 | GntR family transcriptional regulator | - |
PAO1OR_RS00625 | 141947..142333 | + | 387 | WP_014602345.1 | aegerolysin family protein | - |
PAO1OR_RS00630 | 142365..143273 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
PAO1OR_RS00635 | 143573..143854 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
PAO1OR_RS00640 | 143851..144078 | - | 228 | WP_003112628.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PAO1OR_RS00645 | 144254..144874 | - | 621 | WP_003101226.1 | hypothetical protein | - |
PAO1OR_RS00650 | 144975..145475 | + | 501 | WP_003112629.1 | LEA type 2 family protein | - |
PAO1OR_RS00655 | 145548..145889 | + | 342 | WP_003101229.1 | alkylphosphonate utilization protein | - |
PAO1OR_RS00660 | 145971..147398 | - | 1428 | WP_003083784.1 | GABA permease | - |
PAO1OR_RS00665 | 147567..149060 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T285735 WP_003083773.1 NZ_LN871187:c143854-143573 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|