Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) cptAB/Cpta(toxin)
Location 354129..354789 Replicon plasmid 2
Accession NZ_LN868944
Organism Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384

Toxin (Protein)


Gene name cptA Uniprot ID Q57K70
Locus tag AT698_RS19585 Protein ID WP_000244756.1
Coordinates 354129..354542 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name cptB Uniprot ID S5MU13
Locus tag AT698_RS19590 Protein ID WP_000351186.1
Coordinates 354523..354789 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AT698_RS19565 350070..351803 - 1734 WP_000813386.1 single-stranded-DNA-specific exonuclease RecJ -
AT698_RS19570 351809..352522 - 714 WP_000745614.1 bifunctional protein-disulfide isomerase/oxidoreductase DsbC -
AT698_RS19575 352546..353442 - 897 WP_000434303.1 site-specific tyrosine recombinase XerD -
AT698_RS19580 353555..354076 + 522 WP_001055885.1 flavodoxin FldB -
AT698_RS19585 354129..354542 - 414 WP_000244756.1 protein YgfX Toxin
AT698_RS19590 354523..354789 - 267 WP_000351186.1 FAD assembly factor SdhE Antitoxin
AT698_RS19600 355039..356019 + 981 WP_000874178.1 tRNA-modifying protein YgfZ -
AT698_RS19605 356135..356794 - 660 WP_000250289.1 hemolysin III family protein -
AT698_RS19610 356958..357269 - 312 WP_001182976.1 N(4)-acetylcytidine aminohydrolase -
AT698_RS19615 357427..358860 + 1434 WP_023165909.1 6-phospho-beta-glucosidase BglA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - iroB / iroC / iroD / iroN / pipB2 / mig-14 / luxS / avrA / orgC / orgB/SctL / orgA/sctK / prgK / prgJ / prgI / prgH / sptP / sicP / sipA/sspA / sipD / sipC/sspC / sipB/sspB / sicA / spaS / spaR / spaQ / spaP / spaO/sctQ / invJ / invI / invC/sctN / invB / invA / invE / invG / invF / invH / sopD / AHA_3493 / rfaE / acrA / acrB 1..727905 727905


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Inner membrane protein YgfX

(3-131)

Antitoxin

Flavinator of succinate dehydrogenase

(7-79)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 16183.15 Da        Isoelectric Point: 10.7537

>T285727 WP_000244756.1 NZ_LN868944:c354542-354129 [Salmonella enterica subsp. enterica serovar Senftenberg]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH

Download         Length: 414 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10550.05 Da        Isoelectric Point: 6.0783

>AT285727 WP_000351186.1 NZ_LN868944:c354789-354523 [Salmonella enterica subsp. enterica serovar Senftenberg]
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3Z1E9V5

Antitoxin

Source ID Structure
AlphaFold DB A0A5I0YWH4

References