Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 185967..186781 Replicon plasmid 2
Accession NZ_LN868944
Organism Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384

Toxin (Protein)


Gene name TacT3 Uniprot ID A0A8E5IG67
Locus tag AT698_RS18825 Protein ID WP_000971651.1
Coordinates 186254..186781 (+) Length 176 a.a.

Antitoxin (Protein)


Gene name TacA3 Uniprot ID M7S6I2
Locus tag AT698_RS18820 Protein ID WP_000855694.1
Coordinates 185967..186257 (+) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AT698_RS18795 182011..182661 - 651 WP_001728903.1 type III secretion system transcriptional activator InvF -
AT698_RS18800 183118..183561 + 444 WP_000715095.1 SPI-1 type III secretion system invasion lipoprotein InvH -
AT698_RS18805 183993..184442 + 450 WP_000381609.1 hypothetical protein -
AT698_RS18810 184427..184774 + 348 WP_001555786.1 DUF1493 family protein -
AT698_RS18815 185047..185373 - 327 WP_000393295.1 hypothetical protein -
AT698_RS18820 185967..186257 + 291 WP_000855694.1 DUF1778 domain-containing protein Antitoxin
AT698_RS18825 186254..186781 + 528 WP_000971651.1 GNAT family N-acetyltransferase Toxin
AT698_RS24600 186854..187272 - 419 Protein_164 transposase -
AT698_RS18835 187505..188161 + 657 WP_000420450.1 protein-serine/threonine phosphatase -
AT698_RS18840 188406..188900 - 495 WP_000424946.1 hypothetical protein -
AT698_RS18845 188927..189595 - 669 WP_000445914.1 hypothetical protein -
AT698_RS24965 189752..189970 - 219 Protein_168 hypothetical protein -
AT698_RS18855 190181..190579 - 399 Protein_169 cytoplasmic protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - iroB / iroC / iroD / iroN / pipB2 / mig-14 / luxS / avrA / orgC / orgB/SctL / orgA/sctK / prgK / prgJ / prgI / prgH / sptP / sicP / sipA/sspA / sipD / sipC/sspC / sipB/sspB / sicA / spaS / spaR / spaQ / spaP / spaO/sctQ / invJ / invI / invC/sctN / invB / invA / invE / invG / invF / invH / sopD / AHA_3493 / rfaE / acrA / acrB 1..727905 727905
- flank IS/Tn - - 186854..187030 176


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Vibrio phage ICP1, Orf50

(1-95)


Sequences

Toxin        


Download         Length: 176 a.a.        Molecular weight: 18970.77 Da        Isoelectric Point: 9.3905

>T285726 WP_000971651.1 NZ_LN868944:186254-186781 [Salmonella enterica subsp. enterica serovar Senftenberg]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGGYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL

Download         Length: 528 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10664.50 Da        Isoelectric Point: 6.3133

>AT285726 WP_000855694.1 NZ_LN868944:185967-186257 [Salmonella enterica subsp. enterica serovar Senftenberg]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A3V8SJE7

References